(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE246

PENCW_13.PE246       Location/Qualifiers
FT   CDS             join(complement(559360..559761),complement(558277..559272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946644"
FT                   /orf_name="Pc16g02460"
FT                   /product="Pc16g02460 protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92916.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI0001831A41"
FT                   /db_xref="UniProtKB/TrEMBL:B6H767"
FT                   /transl_table=1
FT                   /translation="MVSPNLDSASGTGQYQDHPDAPLPIRVEQSESNSRSEQRSSSTQT
FT                   QTYRDDERGYCESDEAESQPALTQSDPIPIEDDDEAIAIAAASRPRHAWQVWWLRNKGM
FT                   GLVLLAQAFAASMNVMTQVLEIHSSMHPFQILFARMSITAVASYLYMYIASTPSPLGTR
FT                   PVRGLLLLRALFGFTGVYGLYYSVQYLPLSEATVITFLSPIMSCYACSLLIPGETFSRK
FT                   QLLAGLISLGGVVLIARPFSKRDPSMTIATPTATTAWVLGLSTSTVDKPPSETDSYHHV
FT                   MATIVAFLGVLGASGAYTSIRMIGRRAHPLVSVTYFSSVTTVISFVAMLTVPSVPFRVP
FT                   NTVVEWMLLTGLGVCGFLLQFLLTAGLSYVPPASVSDGKPTAQGARATSMVYMQMFFAV
FT                   FYDKVVWGSTLSPISWVGSGIILACAVYVAFAQESPVQQGSGSAEYRDVAGYKDATDEE
FT                   RAEERGN"
     MVSPNLDSAS GTGQYQDHPD APLPIRVEQS ESNSRSEQRS SSTQTQTYRD DERGYCESDE        60
     AESQPALTQS DPIPIEDDDE AIAIAAASRP RHAWQVWWLR NKGMGLVLLA QAFAASMNVM       120
     TQVLEIHSSM HPFQILFARM SITAVASYLY MYIASTPSPL GTRPVRGLLL LRALFGFTGV       180
     YGLYYSVQYL PLSEATVITF LSPIMSCYAC SLLIPGETFS RKQLLAGLIS LGGVVLIARP       240
     FSKRDPSMTI ATPTATTAWV LGLSTSTVDK PPSETDSYHH VMATIVAFLG VLGASGAYTS       300
     IRMIGRRAHP LVSVTYFSSV TTVISFVAML TVPSVPFRVP NTVVEWMLLT GLGVCGFLLQ       360
     FLLTAGLSYV PPASVSDGKP TAQGARATSM VYMQMFFAVF YDKVVWGSTL SPISWVGSGI       420
     ILACAVYVAF AQESPVQQGS GSAEYRDVAG YKDATDEERA EERGN                       465
//

If you have problems or comments...

PBIL Back to PBIL home page