(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE248

PENCW_13.PE248       Location/Qualifiers
FT   CDS             join(564676..564777,564828..565540,565596..565800)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977314"
FT                   /orf_name="Pc16g02480"
FT                   /product="Pc16g02480 protein"
FT                   /protein_id="CAP92918.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0001831A43"
FT                   /db_xref="UniProtKB/TrEMBL:B6H769"
FT                   /transl_table=1
FT                   /translation="MAEDSFLHLARPLGPVSVGTAPTTAPLNVVIQPQAIFSVLDHSLR
FT                   RNADQERVIGTLLGTRSEDGSEVEVRSAFAVGHSEAEDQVEVDMEYHKQMLALHLKANP
FT                   REVLVGWYATASELNTFSALIQNFYSGQGDGTWPHPAVHLTVSTEAGKDLETRAYISAP
FT                   VGVTAERAADSAAFIPVPYELRYGEADKSGLESIANAKDAEDRSTSVTSDIESLERAIE
FT                   EVLSMVDRVSRYVESVIDEETPASTAMGQFLLNALALAPKVEPADIERDFNNHIQDVLV
FT                   VSYLANTVRTQMELSTRLATAQLTLGGGGEGPATEGQRNQRGKGQGRPRQDRAEEARA"
     MAEDSFLHLA RPLGPVSVGT APTTAPLNVV IQPQAIFSVL DHSLRRNADQ ERVIGTLLGT        60
     RSEDGSEVEV RSAFAVGHSE AEDQVEVDME YHKQMLALHL KANPREVLVG WYATASELNT       120
     FSALIQNFYS GQGDGTWPHP AVHLTVSTEA GKDLETRAYI SAPVGVTAER AADSAAFIPV       180
     PYELRYGEAD KSGLESIANA KDAEDRSTSV TSDIESLERA IEEVLSMVDR VSRYVESVID       240
     EETPASTAMG QFLLNALALA PKVEPADIER DFNNHIQDVL VVSYLANTVR TQMELSTRLA       300
     TAQLTLGGGG EGPATEGQRN QRGKGQGRPR QDRAEEARA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page