(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE249

PENCW_13.PE249       Location/Qualifiers
FT   CDS             join(complement(568120..568144),complement(566955..567817))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128420"
FT                   /orf_name="Pc16g02490"
FT                   /product="Pc16g02490 protein"
FT                   /protein_id="CAP92919.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831A44"
FT                   /db_xref="UniProtKB/TrEMBL:B6H770"
FT                   /transl_table=1
FT                   /translation="MVDLLGDKACSWSPARQHACRYQSHVNLFYGVSNRGVWSLGSNLI
FT                   LKERSTEPPNFEVPNIRFLASKTSIPIPRIVEEWQEDDGACFLLTRRIRGQPLSELWPT
FT                   MTSADKERVAKQTAEYLMIQLHELRSNRMESIGGQPIYSAFLFPHTYGIGHGPFSSDDE
FT                   LWAEMSLTLNDQVPEQVRSKLRQRMPTAAPYTFTHGDLTNVNIMVENGNLAGILDWESS
FT                   AFFPVWWEFTCAGIGLGQDDKEWKDLLRSHLPDHTEARNFWLDFFAIHNYPNLNERGLA
FT                   LLKECDLDLPEKET"
     MVDLLGDKAC SWSPARQHAC RYQSHVNLFY GVSNRGVWSL GSNLILKERS TEPPNFEVPN        60
     IRFLASKTSI PIPRIVEEWQ EDDGACFLLT RRIRGQPLSE LWPTMTSADK ERVAKQTAEY       120
     LMIQLHELRS NRMESIGGQP IYSAFLFPHT YGIGHGPFSS DDELWAEMSL TLNDQVPEQV       180
     RSKLRQRMPT AAPYTFTHGD LTNVNIMVEN GNLAGILDWE SSAFFPVWWE FTCAGIGLGQ       240
     DDKEWKDLLR SHLPDHTEAR NFWLDFFAIH NYPNLNERGL ALLKECDLDL PEKET            295
//

If you have problems or comments...

PBIL Back to PBIL home page