(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE25

PENCW_13.PE25        Location/Qualifiers
FT   CDS             join(complement(59480..59499),complement(59176..59386),
FT                   complement(58891..59073))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945515"
FT                   /orf_name="Pc16g00250"
FT                   /product="Putative uncharacterized protein Pc16g00250 "
FT                   /protein_id="CAP92695.1"
FT                   /db_xref="UniParc:UPI0001831DB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T3"
FT                   /transl_table=1
FT                   /translation="MATPVDRTPNGQPRFCWCPAECLAFVVATLTGRALQGPRKHRWLE
FT                   SWDAPGTRKDSQVPVSHCVFEQSYTWKTCVAKERPSIPPPGTIHHTLRVIRANLDFTWF
FT                   CRAVLANIPSQRMFQGPYTRYGDLHNMKGMKWR"
     MATPVDRTPN GQPRFCWCPA ECLAFVVATL TGRALQGPRK HRWLESWDAP GTRKDSQVPV        60
     SHCVFEQSYT WKTCVAKERP SIPPPGTIHH TLRVIRANLD FTWFCRAVLA NIPSQRMFQG       120
     PYTRYGDLHN MKGMKWR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page