(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE250

PENCW_13.PE250       Location/Qualifiers
FT   CDS             join(568592..568672,568821..569007,569100..569218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671379"
FT                   /orf_name="Pc16g02500"
FT                   /product="Putative uncharacterized protein Pc16g02500 "
FT                   /protein_id="CAP92920.1"
FT                   /db_xref="UniParc:UPI0001831A45"
FT                   /db_xref="UniProtKB/TrEMBL:B6H771"
FT                   /transl_table=1
FT                   /translation="MPRLWLLYATHDLLRDRALRYVDYLVSVVPTNSGTTSCDVLLPVV
FT                   DHGTIFVEIRDETTSGYTRQLAVQHRTSGTASNLQVVVLLLVFKDYVNQKKPLKRHKKI
FT                   IREDYLRPPDYDRISGRLFLSIVK"
     MPRLWLLYAT HDLLRDRALR YVDYLVSVVP TNSGTTSCDV LLPVVDHGTI FVEIRDETTS        60
     GYTRQLAVQH RTSGTASNLQ VVVLLLVFKD YVNQKKPLKR HKKIIREDYL RPPDYDRISG       120
     RLFLSIVK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page