(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE251

PENCW_13.PE251       Location/Qualifiers
FT   CDS             join(complement(569965..570025),complement(569394..569890))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946646"
FT                   /orf_name="Pc16g02510"
FT                   /product="Pc16g02510 protein"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="CAP92921.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0001831A46"
FT                   /db_xref="UniProtKB/TrEMBL:B6H772"
FT                   /transl_table=1
FT                   /translation="MAEPRARMARHKGQMNFQNELRLLLLAYGDPSPHPSFPNEPLPET
FT                   VRVLDEIVTDFVLELSHGAAQVAHHARRQKIKVEDFRFALRRDPNKLGRVQELLRMERE
FT                   LKEARKAFDQNDDQVAKEAGKKGAAAAAAAAAAGEDPVAAEAAATATVTKKSKGKGKRG
FT                   AAIRRGSDATEESVSKKRKTIG"
     MAEPRARMAR HKGQMNFQNE LRLLLLAYGD PSPHPSFPNE PLPETVRVLD EIVTDFVLEL        60
     SHGAAQVAHH ARRQKIKVED FRFALRRDPN KLGRVQELLR MERELKEARK AFDQNDDQVA       120
     KEAGKKGAAA AAAAAAAGED PVAAEAAATA TVTKKSKGKG KRGAAIRRGS DATEESVSKK       180
     RKTIG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page