(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE252

PENCW_13.PE252       Location/Qualifiers
FT   CDS             join(570692..570733,570822..570931,571004..571178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946647"
FT                   /orf_name="Pc16g02520"
FT                   /product="Pc16g02520 protein"
FT                   /protein_id="CAP92922.1"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniParc:UPI0001831A47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H773"
FT                   /transl_table=1
FT                   /translation="MVSSCTCQDLWHCCSALFNFQSLLLVILLIICTSSYAHSIMPGIM
FT                   DRNQNGIFGIFWKCARVGERLSPYVSICCVVMAVSSLFHKPRYMKKDTDIACRSQSSSV
FT                   VNLA"
     MVSSCTCQDL WHCCSALFNF QSLLLVILLI ICTSSYAHSI MPGIMDRNQN GIFGIFWKCA        60
     RVGERLSPYV SICCVVMAVS SLFHKPRYMK KDTDIACRSQ SSSVVNLA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page