(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE253

PENCW_13.PE253       Location/Qualifiers
FT   CDS             complement(571478..573880)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946648"
FT                   /orf_name="Pc16g02530"
FT                   /product="Pc16g02530 protein"
FT                   /protein_id="CAP92923.1"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0001831A48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H739"
FT                   /transl_table=1
FT                   /translation="MSSCPHQLVRSRLNGLLSPQCRSAGRWYRESGTANVGHRVRLSTY
FT                   NAPAILEPGVTHDTPDPVSYQHNRGSTSSSHPPTSEQSDQVANDRYGMGHGQTKPPTQS
FT                   RKSSQTPIITNDKMKKVAYVRQADPKLVAMAAERVNREILNKGRHLTDRGLYLSLAMRM
FT                   NSLYTRDLGLRQWKEAYGAIHKAKTYGREVLHKAALPKLREDGEQLLALLLNDCQGKFR
FT                   EAWLAMNRATRAWAWQRLAGWLLQNNPAMALEFLLVTTEPRDKPDFTMVVDCLAYLEKF
FT                   HYEELRDWTKGVHTFESVVATCLDPKDWPIISPPQKGIRFYIRRAGFLGVYESFRLMNE
FT                   RGITMEAQTALCYMYRFTQLNDVEYALRALEFIPKINDPGFSMDSEGVLRHCCKLLTLD
FT                   TVEDKAGGRNFRILPRLLKMGVQPDRDMMNIVLANAYKTGDPQLGADMLQFMKNHHHDF
FT                   DSYTYLTLLTDAVSRGDRGRVDELVREVEMQEDIRNNPYIFSKIFHAHFTFTAKHIDPE
FT                   SDPAGVFYSMLDMYNKIHDITPLKELLLLPPHYTAPPTQGLEVKTPPSPVSLFLMIATF
FT                   FRCRNRISQVHHMYDRFRELVQQGHPSIAPLVETDHVYNEFLIAFRKSSRGLRSSIRLV
FT                   EDMLDASALPKETTAGKPLKHVSPTPRTWTILLSAFNYSRQPDAAEKVKEMMAKHDVEY
FT                   NQVTWNTIINGYANAQDIPETANAIKKMEKDGFAIDHYTMKSLRYLRDPERLWVAIEEM
FT                   DEGLDLDGTHKLLTLEPASDVHTDQKEQDELIDNGLEKLESKLKPKM"
     MSSCPHQLVR SRLNGLLSPQ CRSAGRWYRE SGTANVGHRV RLSTYNAPAI LEPGVTHDTP        60
     DPVSYQHNRG STSSSHPPTS EQSDQVANDR YGMGHGQTKP PTQSRKSSQT PIITNDKMKK       120
     VAYVRQADPK LVAMAAERVN REILNKGRHL TDRGLYLSLA MRMNSLYTRD LGLRQWKEAY       180
     GAIHKAKTYG REVLHKAALP KLREDGEQLL ALLLNDCQGK FREAWLAMNR ATRAWAWQRL       240
     AGWLLQNNPA MALEFLLVTT EPRDKPDFTM VVDCLAYLEK FHYEELRDWT KGVHTFESVV       300
     ATCLDPKDWP IISPPQKGIR FYIRRAGFLG VYESFRLMNE RGITMEAQTA LCYMYRFTQL       360
     NDVEYALRAL EFIPKINDPG FSMDSEGVLR HCCKLLTLDT VEDKAGGRNF RILPRLLKMG       420
     VQPDRDMMNI VLANAYKTGD PQLGADMLQF MKNHHHDFDS YTYLTLLTDA VSRGDRGRVD       480
     ELVREVEMQE DIRNNPYIFS KIFHAHFTFT AKHIDPESDP AGVFYSMLDM YNKIHDITPL       540
     KELLLLPPHY TAPPTQGLEV KTPPSPVSLF LMIATFFRCR NRISQVHHMY DRFRELVQQG       600
     HPSIAPLVET DHVYNEFLIA FRKSSRGLRS SIRLVEDMLD ASALPKETTA GKPLKHVSPT       660
     PRTWTILLSA FNYSRQPDAA EKVKEMMAKH DVEYNQVTWN TIINGYANAQ DIPETANAIK       720
     KMEKDGFAID HYTMKSLRYL RDPERLWVAI EEMDEGLDLD GTHKLLTLEP ASDVHTDQKE       780
     QDELIDNGLE KLESKLKPKM                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page