(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE254

PENCW_13.PE254       Location/Qualifiers
FT   CDS             574183..574785
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208532" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977315"
FT                   /orf_name="Pc16g02540"
FT                   /product="Pc16g02540 protein"
FT                   /protein_id="CAP92924.1"
FT                   /db_xref="InterPro:IPR013169"
FT                   /db_xref="UniParc:UPI0001831A49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H740"
FT                   /transl_table=1
FT                   /translation="MSSSHANLDAASTDRKARLAKLAALKRKQPEQDTNEAGAVDRELP
FT                   DADTTPDVTAKYLSGRNYDPETRGPKLGFEQGPQEGQVTLEAQAAEIARATAEQSKEDT
FT                   GADEPLDLFKLQPKKPNWDLKRDLDEKLKILNVRTENAIARIVRQRVEDAKRAAKARGP
FT                   KSNGDEEGEEVGMEGETLVEGIHMREREEEKSDEETI"
     MSSSHANLDA ASTDRKARLA KLAALKRKQP EQDTNEAGAV DRELPDADTT PDVTAKYLSG        60
     RNYDPETRGP KLGFEQGPQE GQVTLEAQAA EIARATAEQS KEDTGADEPL DLFKLQPKKP       120
     NWDLKRDLDE KLKILNVRTE NAIARIVRQR VEDAKRAAKA RGPKSNGDEE GEEVGMEGET       180
     LVEGIHMRER EEEKSDEETI                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page