(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE255

PENCW_13.PE255       Location/Qualifiers
FT   CDS             join(complement(576095..576189),complement(575911..576069),
FT                   complement(575191..575839))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977316"
FT                   /orf_name="Pc16g02550"
FT                   /product="Pc16g02550 protein"
FT                   /protein_id="CAP92925.1"
FT                   /db_xref="UniParc:UPI0001831A4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H741"
FT                   /transl_table=1
FT                   /translation="MNRYRNAPRLGGSNSNKATATTLCQKCLGRDILLTNSDPRHYSFD
FT                   CKASAQERPYIPRPSRTQQLLNPELMPKLSSENPNELLRKEGVADELLATREEERGRKR
FT                   DLDDMTDRNAQSPGRARSLSVETISTNRSYSSSPRRNKRGAADRGRRDDSSAPPAKSRK
FT                   RRYSDSTEGSSGSVHSGPKDRSPSRERTRTDDRNTRRRRRESSPEERGRHRRAGRHSER
FT                   RDRRSKSLDKDRVEESRATAQDVPKDRSYRDRASPPRQSQHERSRPDPIMQKNQPPRER
FT                   SLSPFSKRLALTQAMNNGR"
     MNRYRNAPRL GGSNSNKATA TTLCQKCLGR DILLTNSDPR HYSFDCKASA QERPYIPRPS        60
     RTQQLLNPEL MPKLSSENPN ELLRKEGVAD ELLATREEER GRKRDLDDMT DRNAQSPGRA       120
     RSLSVETIST NRSYSSSPRR NKRGAADRGR RDDSSAPPAK SRKRRYSDST EGSSGSVHSG       180
     PKDRSPSRER TRTDDRNTRR RRRESSPEER GRHRRAGRHS ERRDRRSKSL DKDRVEESRA       240
     TAQDVPKDRS YRDRASPPRQ SQHERSRPDP IMQKNQPPRE RSLSPFSKRL ALTQAMNNGR       300
//

If you have problems or comments...

PBIL Back to PBIL home page