(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE256

PENCW_13.PE256       Location/Qualifiers
FT   CDS             join(576968..577018,577074..579485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671380"
FT                   /orf_name="Pc16g02560"
FT                   /product="Pc16g02560 protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP92926.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI0001831A4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H742"
FT                   /transl_table=1
FT                   /translation="MASKSPPGGDSPLSFAKIAAMPAPLKPHSSSVSDENEICQPTEQP
FT                   PFSEANGSGAALPSQHNLDKTPEASSVDLAVDDLGRGVQDIGLTLKKHSDDPSSLAGGQ
FT                   DNGLLKRENSFEDDRTHLSTSSTKMTNFDSKSLASVTTFAMDEKDSVRPDDSASVQAID
FT                   EEESLSGLASGAPNSVAGSEAGSRAFRDHYRDGIPTRPRGILPVPRLFDGTQPANGTIP
FT                   PDSVANNFVIPANPNGIEDGQILHGFPLEPDEKLLEAMKSPKDRLLILQLEEKIRYFIK
FT                   DCNEQSLELPPSNAFGRLLAHKLGDYYHLTHFVDNNVTSVRLHRTPFCRLPTPLSDVHA
FT                   ACNSTPPPVVPAMKIMRRNDGGQFEGSIGGSSNPSKANSEDGDSGPDGERHGSSSGATP
FT                   AKDRMALTREEREAKYHEVRERIFRDFPDSAKSDPASGDSNPNMSRSSSASGRKKNPRQ
FT                   RTPHDDSFEVRSQFNAYYPGMQYGNGTAQYNAPVNDGSYPNQVPYLVGPGVPPPSGGYM
FT                   PSGQNGAIYPGQLNMNMNGVSQYPTMSPQVASNGSWQGGNMPQQSPYSGYASMSQQGMM
FT                   NQPSSNASSPAMNNYAVPNVAPYQQTPNWSSPPFPTNFQQSPHQRNGPVHWPNYPQQPM
FT                   TSSMPPNMGPNMPSNMGAYPYAQYPGQHMNPGLQHSAGSHAAMQAGYARSHFNPQTRSF
FT                   IPGGAPLGRHPNKSQHTMQPYGNMQSGAQPQWNGYPEPIPNRTMDSTPAMNSNRVPTGP
FT                   RDSIAKWGTPAHLPPKPPPSEVPSDFDLKNRPVPASVPAPTYSSNGIPAVSNGPLVVSG
FT                   GTTVSKPN"
     MASKSPPGGD SPLSFAKIAA MPAPLKPHSS SVSDENEICQ PTEQPPFSEA NGSGAALPSQ        60
     HNLDKTPEAS SVDLAVDDLG RGVQDIGLTL KKHSDDPSSL AGGQDNGLLK RENSFEDDRT       120
     HLSTSSTKMT NFDSKSLASV TTFAMDEKDS VRPDDSASVQ AIDEEESLSG LASGAPNSVA       180
     GSEAGSRAFR DHYRDGIPTR PRGILPVPRL FDGTQPANGT IPPDSVANNF VIPANPNGIE       240
     DGQILHGFPL EPDEKLLEAM KSPKDRLLIL QLEEKIRYFI KDCNEQSLEL PPSNAFGRLL       300
     AHKLGDYYHL THFVDNNVTS VRLHRTPFCR LPTPLSDVHA ACNSTPPPVV PAMKIMRRND       360
     GGQFEGSIGG SSNPSKANSE DGDSGPDGER HGSSSGATPA KDRMALTREE REAKYHEVRE       420
     RIFRDFPDSA KSDPASGDSN PNMSRSSSAS GRKKNPRQRT PHDDSFEVRS QFNAYYPGMQ       480
     YGNGTAQYNA PVNDGSYPNQ VPYLVGPGVP PPSGGYMPSG QNGAIYPGQL NMNMNGVSQY       540
     PTMSPQVASN GSWQGGNMPQ QSPYSGYASM SQQGMMNQPS SNASSPAMNN YAVPNVAPYQ       600
     QTPNWSSPPF PTNFQQSPHQ RNGPVHWPNY PQQPMTSSMP PNMGPNMPSN MGAYPYAQYP       660
     GQHMNPGLQH SAGSHAAMQA GYARSHFNPQ TRSFIPGGAP LGRHPNKSQH TMQPYGNMQS       720
     GAQPQWNGYP EPIPNRTMDS TPAMNSNRVP TGPRDSIAKW GTPAHLPPKP PPSEVPSDFD       780
     LKNRPVPASV PAPTYSSNGI PAVSNGPLVV SGGTTVSKPN                             820
//

If you have problems or comments...

PBIL Back to PBIL home page