(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE26

PENCW_13.PE26        Location/Qualifiers
FT   CDS             join(59741..59858,59917..60000,60057..60166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977035"
FT                   /orf_name="Pc16g00260"
FT                   /product="Pc16g00260 protein"
FT                   /protein_id="CAP92696.1"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniParc:UPI0001831DB7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T4"
FT                   /transl_table=1
FT                   /translation="MPSSLSSSEHSGSVESNHSPSNSLQTKADPNMALHEQEPTAVNLQ
FT                   PGSRDTFSLRSIQHRDREGKVITDPDLSNPTRSRFERPLDTIRSFDAAIDAHRKQQRM"
     MPSSLSSSEH SGSVESNHSP SNSLQTKADP NMALHEQEPT AVNLQPGSRD TFSLRSIQHR        60
     DREGKVITDP DLSNPTRSRF ERPLDTIRSF DAAIDAHRKQ QRM                         103
//

If you have problems or comments...

PBIL Back to PBIL home page