(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE262

PENCW_13.PE262       Location/Qualifiers
FT   CDS             join(complement(591374..591471),complement(590999..591294),
FT                   complement(590108..590945),complement(589966..590038))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946652"
FT                   /orf_name="Pc16g02620"
FT                   /product="Pc16g02620 protein"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92932.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI0001831B11"
FT                   /db_xref="UniProtKB/TrEMBL:B6H748"
FT                   /transl_table=1
FT                   /translation="MPSSSLALTPGLGSFLKCLKTNPIDTSIETLISLLKRRQIRHSRS
FT                   CATATAYLLRSVISACRTTDSAKLIERVQSVGRRLMAAQPREMVVGNIVRRVLGLIRDE
FT                   AEDDRDAEFALSDIGSESQPQTPRAYDDASLPLDRDSPSFRAEDRSSRPPLTSMFSLLS
FT                   HPEPEISLPSTPGSSSPSGRFTGHGPSKDVRAEVLEGIGEIIDELGQVDDQIAAYALDH
FT                   IHSNEIILTHTSSTTVQKFLLKAAAKRKFTVIHAESYPNNHEATHATVSGSAVSDDDNL
FT                   GLEAFQKPLIEHGITVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARA
FT                   AKVHQTPVVVVSGVYKLSPVYPFDFDSLIEYGDPSKVLPYEEGDLVDLVDVQNPIYDYV
FT                   PAELVDLYITNLGGHAPSYLYRIVSDHYRKEDISF"
     MPSSSLALTP GLGSFLKCLK TNPIDTSIET LISLLKRRQI RHSRSCATAT AYLLRSVISA        60
     CRTTDSAKLI ERVQSVGRRL MAAQPREMVV GNIVRRVLGL IRDEAEDDRD AEFALSDIGS       120
     ESQPQTPRAY DDASLPLDRD SPSFRAEDRS SRPPLTSMFS LLSHPEPEIS LPSTPGSSSP       180
     SGRFTGHGPS KDVRAEVLEG IGEIIDELGQ VDDQIAAYAL DHIHSNEIIL THTSSTTVQK       240
     FLLKAAAKRK FTVIHAESYP NNHEATHATV SGSAVSDDDN LGLEAFQKPL IEHGITVILI       300
     PDSAVFALMS RVNKVILGTH SVLANGGLVA AAGTRVIARA AKVHQTPVVV VSGVYKLSPV       360
     YPFDFDSLIE YGDPSKVLPY EEGDLVDLVD VQNPIYDYVP AELVDLYITN LGGHAPSYLY       420
     RIVSDHYRKE DISF                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page