(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE263

PENCW_13.PE263       Location/Qualifiers
FT   CDS             join(592049..593453,593506..593648)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824080"
FT                   /orf_name="Pc16g02630"
FT                   /product="Pc16g02630 protein"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAP92933.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001831B12"
FT                   /db_xref="UniProtKB/TrEMBL:B6H749"
FT                   /transl_table=1
FT                   /translation="MNSLNILSSRVIGQSSSSSRHRSQSQGDGKRAPLPSDFSKLRSYS
FT                   EDNFRSLDPTEKSYNDGLPVGEDREEDAPYDLDEKTPLLHEAHKNGTLTARSTWRLITQ
FT                   RFFDAITETIKFILSTIAAPGVYLAQCFQADDGHYSLLAPVRKLRRSSADPTIRSAKGA
FT                   TRVEGRRRSGSTRKLRPQGSHESIVSTTSESDTDRRHVKNLSSGRNRPIKTKGHDPDPI
FT                   PEGEEHEHTPRRSIRIKLHNEESLKRQRQRRSQSADLGHPMPEGVSRVQGAVHLDSLKS
FT                   PTSPNIHRITKYPHSPTPPRPLLPPRVPSYTAPPRNARAPQKTLVLDLDETLIHSLAKG
FT                   GRMSSGHMVEVKLSIPTTTSLSPGGPQTTLGPQHPILYYVHKRPHCDEFLRKVSKWYKL
FT                   VIFTASVQEYADPVIDWLEQERKYFQGRLYRQHCTFRNGAYIKDLSSVEPDLSKVMILD
FT                   NSPMSYIFHEDNAIPIEGWINDPTDNGLLHLVPMLEALQYVTDVRALLALRRGELES"
     MNSLNILSSR VIGQSSSSSR HRSQSQGDGK RAPLPSDFSK LRSYSEDNFR SLDPTEKSYN        60
     DGLPVGEDRE EDAPYDLDEK TPLLHEAHKN GTLTARSTWR LITQRFFDAI TETIKFILST       120
     IAAPGVYLAQ CFQADDGHYS LLAPVRKLRR SSADPTIRSA KGATRVEGRR RSGSTRKLRP       180
     QGSHESIVST TSESDTDRRH VKNLSSGRNR PIKTKGHDPD PIPEGEEHEH TPRRSIRIKL       240
     HNEESLKRQR QRRSQSADLG HPMPEGVSRV QGAVHLDSLK SPTSPNIHRI TKYPHSPTPP       300
     RPLLPPRVPS YTAPPRNARA PQKTLVLDLD ETLIHSLAKG GRMSSGHMVE VKLSIPTTTS       360
     LSPGGPQTTL GPQHPILYYV HKRPHCDEFL RKVSKWYKLV IFTASVQEYA DPVIDWLEQE       420
     RKYFQGRLYR QHCTFRNGAY IKDLSSVEPD LSKVMILDNS PMSYIFHEDN AIPIEGWIND       480
     PTDNGLLHLV PMLEALQYVT DVRALLALRR GELES                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page