(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE264

PENCW_13.PE264       Location/Qualifiers
FT   CDS             join(complement(594838..594873),complement(594767..594792),
FT                   complement(594661..594681),complement(594106..594334),
FT                   complement(593945..594013))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946653"
FT                   /orf_name="Pc16g02640"
FT                   /product="Putative uncharacterized protein Pc16g02640 "
FT                   /protein_id="CAP92934.1"
FT                   /db_xref="UniParc:UPI0001831B13"
FT                   /db_xref="UniProtKB/TrEMBL:B6H750"
FT                   /transl_table=1
FT                   /translation="MAKRLLSPLECQAGSANQITTGGNQQGGVRSAGGKTGLCLASAAV
FT                   PPRQHYEAHCAGMTTSRAGHNAAKIVLPIIHHFLEGWFPRKPLNLLRSAANAAKEKAQR
FT                   LIFSRDNGRKSWHGFVAWDQRG"
     MAKRLLSPLE CQAGSANQIT TGGNQQGGVR SAGGKTGLCL ASAAVPPRQH YEAHCAGMTT        60
     SRAGHNAAKI VLPIIHHFLE GWFPRKPLNL LRSAANAAKE KAQRLIFSRD NGRKSWHGFV       120
     AWDQRG                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page