(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE265

PENCW_13.PE265       Location/Qualifiers
FT   CDS             join(595358..595978,596057..596340,596431..596788)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235074" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977317"
FT                   /orf_name="Pc16g02650"
FT                   /product="Pc16g02650 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92935.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001831B14"
FT                   /db_xref="UniProtKB/TrEMBL:B6H751"
FT                   /transl_table=1
FT                   /translation="MSIRRRTAHRRRAGDQRLRFDENGTFQISVFSDLHFAEGTITDLN
FT                   HCLGILTIFKDDEEDHKTTGVMRSVLSSEEAQLVVLNGDLISGEATQSSNSTLYVDRVV
FT                   APLVDLDLPWASTYGNHDSEINLDPEELFRRETEYRNSLTQRDILDPAAGITNYYLPIF
FT                   PHGASNDSIPVFILWFFDSQGGHYPLTENDDGKATKRQNWVDDTVIEWFVKANANLTST
FT                   YGQTIPSLAFVHIPVYAMRAFQETGVSPTTEPGINGERVQQQGYEPDSGYHYQDFPFIN
FT                   ALLNTTGLAATFSGHDHDNDWCFRWDSKLPNLNVTGNGMSMCYGRHTGYGGYGDRARGG
FT                   RQILLDERLLGDDIRTWIRMEDGSISGDVHLNATYGHDHYGLVERSIVNGQNGGLSPPC
FT                   LGVICLWICVFSGLISGFHLW"
     MSIRRRTAHR RRAGDQRLRF DENGTFQISV FSDLHFAEGT ITDLNHCLGI LTIFKDDEED        60
     HKTTGVMRSV LSSEEAQLVV LNGDLISGEA TQSSNSTLYV DRVVAPLVDL DLPWASTYGN       120
     HDSEINLDPE ELFRRETEYR NSLTQRDILD PAAGITNYYL PIFPHGASND SIPVFILWFF       180
     DSQGGHYPLT ENDDGKATKR QNWVDDTVIE WFVKANANLT STYGQTIPSL AFVHIPVYAM       240
     RAFQETGVSP TTEPGINGER VQQQGYEPDS GYHYQDFPFI NALLNTTGLA ATFSGHDHDN       300
     DWCFRWDSKL PNLNVTGNGM SMCYGRHTGY GGYGDRARGG RQILLDERLL GDDIRTWIRM       360
     EDGSISGDVH LNATYGHDHY GLVERSIVNG QNGGLSPPCL GVICLWICVF SGLISGFHLW       420
//

If you have problems or comments...

PBIL Back to PBIL home page