(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE266

PENCW_13.PE266       Location/Qualifiers
FT   CDS             join(598244..598343,598418..598665,598729..599178,
FT                   599249..599818)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977562"
FT                   /orf_name="Pc16g02660"
FT                   /product="Pc16g02660 protein"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAP92936.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI0001831B15"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I2"
FT                   /transl_table=1
FT                   /translation="MRLSGTWSISNGLIATLLFSTLTPAIELDLNDEQSIKDAASTSTY
FT                   SMMGWYYGNETGQIPGSFPEKWWEGSALFLALLQYWHFTGDTTYNSLMSEGMQWQSGEE
FT                   GDYMPSNYSSYLGNDDQMFWGLAAMMAAELKFPDVEDGFSWLSLAQGVFNTQTARWDTT
FT                   TCGGGLRWQLFPYQSGYTMKNSVSNGGLFQLAARLARYTDDDKYSKWAEKIWDWSTSSP
FT                   LVNNKTWNVADSTQMANDCADSGNYQWTYNYGAYLMGAVYMYNYTNGDEKWKKPVDGLL
FT                   GKTLKTFFPNGDVIEDVTCEPIKMCNFNEILFKGLTSSWLAFTTLLAPDTAAQIKPKLA
FT                   SSAEAAAKSCTGNNNNTCGITWYQNKWDGTTGMEQEISATNVFLANLINYNTGSFGPVT
FT                   SKTGGNSASDPNAGSENDDEKKMKPITTGDKAGASILTLIFVFGWAGAVAFMMLGG"
     MRLSGTWSIS NGLIATLLFS TLTPAIELDL NDEQSIKDAA STSTYSMMGW YYGNETGQIP        60
     GSFPEKWWEG SALFLALLQY WHFTGDTTYN SLMSEGMQWQ SGEEGDYMPS NYSSYLGNDD       120
     QMFWGLAAMM AAELKFPDVE DGFSWLSLAQ GVFNTQTARW DTTTCGGGLR WQLFPYQSGY       180
     TMKNSVSNGG LFQLAARLAR YTDDDKYSKW AEKIWDWSTS SPLVNNKTWN VADSTQMAND       240
     CADSGNYQWT YNYGAYLMGA VYMYNYTNGD EKWKKPVDGL LGKTLKTFFP NGDVIEDVTC       300
     EPIKMCNFNE ILFKGLTSSW LAFTTLLAPD TAAQIKPKLA SSAEAAAKSC TGNNNNTCGI       360
     TWYQNKWDGT TGMEQEISAT NVFLANLINY NTGSFGPVTS KTGGNSASDP NAGSENDDEK       420
     KMKPITTGDK AGASILTLIF VFGWAGAVAF MMLGG                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page