(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE267

PENCW_13.PE267       Location/Qualifiers
FT   CDS             600584..602140
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824330"
FT                   /orf_name="Pc16g02670"
FT                   /product="Pc16g02670 protein"
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92937.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B16"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I3"
FT                   /transl_table=1
FT                   /translation="MVAITWTDRQPDAVHEESYHVDETTALLASGKTKHGGAPTSDTLD
FT                   SSSGPDGDNDGNNDNDDEKKPLPIAQILLLCYARAVEPLAFFSIFPYVSQMVQDNGGLA
FT                   DADVGFYSGLIESMFSLTQAIVMIFWGQAADRFGRKPVLVSSLFGVTVATSLFGLAKTI
FT                   PQMIMFRCLAGVFAGTIVTIRTMVAEHSTPNTQARAFSWFAFSGNLGIFLGPLLGGALA
FT                   DPVRQYPGVFGAVHFFEKYPYALSSLVVASVGATAAVSSACFVEETLKKEPVTVGHDGE
FT                   EAASDVPTQSSDLSTWELLKSPGVGMVLYAYGHIMVLAFAFTAIIPVFWFTPVHLGGYG
FT                   FTPLQISLMMGLNGAAQATWLLLVFPPLQKKIGSNGVIRLCATGYPLFFLCCPLGNVLL
FT                   RIGTDGSVKAFWIILPITLAIGCGVSMSFTAIQLALNDVAPSPKVLGTLNALALTGVSA
FT                   LRAFCPALFTTLFALGARTQLAGGYAIWVLMLIIASGLSVTAKYLPEPEAARKRRSSQP
FT                   R"
     MVAITWTDRQ PDAVHEESYH VDETTALLAS GKTKHGGAPT SDTLDSSSGP DGDNDGNNDN        60
     DDEKKPLPIA QILLLCYARA VEPLAFFSIF PYVSQMVQDN GGLADADVGF YSGLIESMFS       120
     LTQAIVMIFW GQAADRFGRK PVLVSSLFGV TVATSLFGLA KTIPQMIMFR CLAGVFAGTI       180
     VTIRTMVAEH STPNTQARAF SWFAFSGNLG IFLGPLLGGA LADPVRQYPG VFGAVHFFEK       240
     YPYALSSLVV ASVGATAAVS SACFVEETLK KEPVTVGHDG EEAASDVPTQ SSDLSTWELL       300
     KSPGVGMVLY AYGHIMVLAF AFTAIIPVFW FTPVHLGGYG FTPLQISLMM GLNGAAQATW       360
     LLLVFPPLQK KIGSNGVIRL CATGYPLFFL CCPLGNVLLR IGTDGSVKAF WIILPITLAI       420
     GCGVSMSFTA IQLALNDVAP SPKVLGTLNA LALTGVSALR AFCPALFTTL FALGARTQLA       480
     GGYAIWVLML IIASGLSVTA KYLPEPEAAR KRRSSQPR                               518
//

If you have problems or comments...

PBIL Back to PBIL home page