(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE268

PENCW_13.PE268       Location/Qualifiers
FT   CDS             join(603728..603893,603945..604256,604306..604720,
FT                   604792..605259,605316..605475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947668"
FT                   /orf_name="Pc16g02680"
FT                   /product="Pc16g02680 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92938.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B17"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I4"
FT                   /transl_table=1
FT                   /translation="MIQIHGVTSATETPHVSEKDAALAVVSDVAQEIDPVVEKRVLRKI
FT                   DWYLMPAMLIGYGMVYYDKAILGSAALFGMTTDLELSVKDYSTSPPTVDTSRLGWATSI
FT                   FYFGMLAGLYPMTFILQRFNIRTVLGPVVLVWAVICAATAGVSTWQGLYVQRFFLGFIE
FT                   SVIPTGFMTIVSGYYTQEEQALRQAWWFSGTGWFTIIGSALNYGFGQITSGSLKRWQYI
FT                   YILAGALTFLFGLWCCTMPNSPVSAWFLTPEERMVAVERLRKGQTGVRCQKIKLDQIKE
FT                   CLTDVKIYLVAIMMAAAYTINGAISGFGPLIVSTFGYDTLDSILFQFPVGGVCVIFIPL
FT                   CGYISTIVPNVRIPMLIACCLPVIAGCVMIWKSEWGYRPVTPVVGYALTGFFGPVVSLI
FT                   ITTGACNVAGATKKTVMAATVFVAYTVGNIIGPQLVKSDTKAQHYPELWTGMIICYCIT
FT                   IAAAVVLYLVLRRENRIRGQLDLDEVQRDKIAFDDLTDKQNPFFRYAL"
     MIQIHGVTSA TETPHVSEKD AALAVVSDVA QEIDPVVEKR VLRKIDWYLM PAMLIGYGMV        60
     YYDKAILGSA ALFGMTTDLE LSVKDYSTSP PTVDTSRLGW ATSIFYFGML AGLYPMTFIL       120
     QRFNIRTVLG PVVLVWAVIC AATAGVSTWQ GLYVQRFFLG FIESVIPTGF MTIVSGYYTQ       180
     EEQALRQAWW FSGTGWFTII GSALNYGFGQ ITSGSLKRWQ YIYILAGALT FLFGLWCCTM       240
     PNSPVSAWFL TPEERMVAVE RLRKGQTGVR CQKIKLDQIK ECLTDVKIYL VAIMMAAAYT       300
     INGAISGFGP LIVSTFGYDT LDSILFQFPV GGVCVIFIPL CGYISTIVPN VRIPMLIACC       360
     LPVIAGCVMI WKSEWGYRPV TPVVGYALTG FFGPVVSLII TTGACNVAGA TKKTVMAATV       420
     FVAYTVGNII GPQLVKSDTK AQHYPELWTG MIICYCITIA AAVVLYLVLR RENRIRGQLD       480
     LDEVQRDKIA FDDLTDKQNP FFRYAL                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page