(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE269

PENCW_13.PE269       Location/Qualifiers
FT   CDS             join(605707..605879,605954..606339,606404..606674,
FT                   606738..607380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947669"
FT                   /orf_name="Pc16g02690"
FT                   /product="Pc16g02690 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92939.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831B18"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I5"
FT                   /transl_table=1
FT                   /translation="MEDPKQSPAVALCGDDTIFRDPRYEVTWESGDSENPRTWSVWYRG
FT                   FIVASMSFSTTIVVIYTTMYTSGVEGIQKEFNISSKLVVLLGLTTNLFGLALGSVILSS
FT                   LSEIYGRRPVYLVSVLLFGLLTLPVALANNIEAILISRFFGGFFGGTMIASAPGSVTDV
FT                   TDDQYRALALSCWSLGTMNGPVLGPIIGGFVYQYLGWRWLNWLVLICSGISLCLMFLVK
FT                   ETYSPALLRQKTIKRQKMTGDRRWWCRFDHEETGLQVLKTNLIRPLRMAVLEPICIFWN
FT                   LYVGVVYSVLFLCFVAYPIVFEGARGWTPGLAGLSYCGIGTGTAIAVGLEPLIRKIIAL
FT                   HPHDPSTSRPAPEAAVIAVCIGSVLIPIGEFWFSWTAQPSVHWILPILAGIPFGLGNGL
FT                   VFIYATNYMAGSYTVYAASALAGNSIVRYGLAGVLPLAGEKMYSTLGANWAGTMLALIE
FT                   VILIPIPFIFYKYGHHIRLRSPMIVKRDMDSS"
     MEDPKQSPAV ALCGDDTIFR DPRYEVTWES GDSENPRTWS VWYRGFIVAS MSFSTTIVVI        60
     YTTMYTSGVE GIQKEFNISS KLVVLLGLTT NLFGLALGSV ILSSLSEIYG RRPVYLVSVL       120
     LFGLLTLPVA LANNIEAILI SRFFGGFFGG TMIASAPGSV TDVTDDQYRA LALSCWSLGT       180
     MNGPVLGPII GGFVYQYLGW RWLNWLVLIC SGISLCLMFL VKETYSPALL RQKTIKRQKM       240
     TGDRRWWCRF DHEETGLQVL KTNLIRPLRM AVLEPICIFW NLYVGVVYSV LFLCFVAYPI       300
     VFEGARGWTP GLAGLSYCGI GTGTAIAVGL EPLIRKIIAL HPHDPSTSRP APEAAVIAVC       360
     IGSVLIPIGE FWFSWTAQPS VHWILPILAG IPFGLGNGLV FIYATNYMAG SYTVYAASAL       420
     AGNSIVRYGL AGVLPLAGEK MYSTLGANWA GTMLALIEVI LIPIPFIFYK YGHHIRLRSP       480
     MIVKRDMDSS                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page