(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE27

PENCW_13.PE27        Location/Qualifiers
FT   CDS             join(61674..61748,61808..61845,61975..62711,62765..63471)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823843"
FT                   /orf_name="Pc16g00270"
FT                   /product="Pc16g00270 protein"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92697.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831DB8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T5"
FT                   /transl_table=1
FT                   /translation="MKFSLVALATLAGVAVADLDPIVIKGSKFFYSSNDTQFTTSSGYI
FT                   DPLADPTACARDVPMLAKLRTNVIRTYAINASADHSECMKLLADAGIYVISDLSQPKLS
FT                   IDRSDPTWETDLFARYTSVVDELAQYNNTIGFFAGNEVANSVNTSDSSAFVKAAVRDTK
FT                   KYIKDKGYRPMGVGYATADVADIRADMADYFNCGEADESIDFWGYNIYSWCGESTYAKS
FT                   GYKDRTEEFANYSVPVFFAEYGCNEVTPREFTDVKALYGEPMADVWSGGIVYMYFQEAN
FT                   NYGLVSVVDSTSVSTLADFKYYSSQIASVNPTGVKKASYTPTNTALRSCPTVGSSWSAE
FT                   PSPLPPVADIQLCDCMYDASACVVADSLSSTKYSKLFSTVCGYTDCSGLTANATTGEYG
FT                   AYSMCSTKQQLAFALNKYYVEQNRAADACSFAGSATVKSVTKATGTCATQMKEAGTAGT
FT                   GTITTENTGIAGSGSASSTGSSTTSSSGAISMHSSSSFGSFQVAAYIATALLAGVGMIA
FT                   L"
     MKFSLVALAT LAGVAVADLD PIVIKGSKFF YSSNDTQFTT SSGYIDPLAD PTACARDVPM        60
     LAKLRTNVIR TYAINASADH SECMKLLADA GIYVISDLSQ PKLSIDRSDP TWETDLFARY       120
     TSVVDELAQY NNTIGFFAGN EVANSVNTSD SSAFVKAAVR DTKKYIKDKG YRPMGVGYAT       180
     ADVADIRADM ADYFNCGEAD ESIDFWGYNI YSWCGESTYA KSGYKDRTEE FANYSVPVFF       240
     AEYGCNEVTP REFTDVKALY GEPMADVWSG GIVYMYFQEA NNYGLVSVVD STSVSTLADF       300
     KYYSSQIASV NPTGVKKASY TPTNTALRSC PTVGSSWSAE PSPLPPVADI QLCDCMYDAS       360
     ACVVADSLSS TKYSKLFSTV CGYTDCSGLT ANATTGEYGA YSMCSTKQQL AFALNKYYVE       420
     QNRAADACSF AGSATVKSVT KATGTCATQM KEAGTAGTGT ITTENTGIAG SGSASSTGSS       480
     TTSSSGAISM HSSSSFGSFQ VAAYIATALL AGVGMIAL                               518
//

If you have problems or comments...

PBIL Back to PBIL home page