(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE270

PENCW_13.PE270       Location/Qualifiers
FT   CDS             join(complement(610206..610312),complement(609238..609955),
FT                   complement(608593..609171),complement(607565..608527))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947670"
FT                   /orf_name="Pc16g02700"
FT                   /product="Pc16g02700 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92940.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831B19"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I6"
FT                   /transl_table=1
FT                   /translation="MRRKHGGHSRIAIETSSNTKEPISNVVVSVSAGKLKQGKSRFIEP
FT                   QDKSDQNTSRSPKLYTRSHQEDVPEDQNGHKGLPDESITPFSGETSLAHNMTVVEDRLE
FT                   QMGVRYARLRSESPNHSFSSQLTPSPQASPKGNRPQQTKSYVYQALDSHKIVPDRVQWD
FT                   RAMKTFCDEVHILVPFLHLPSVWEAYERLWESFLVPSANHYSRGEWRFTFACVLLCLAN
FT                   GTCVESSRVDGQQGQYSAGWSLYRAARDVIGDLLDVFGECTDQILLLQNILLMVIYLFR
FT                   LDSHGPAEKLLALSISHSHHIGLQRRQVVEAMNPFESEMARRLWWCIYLMDRRLAIETG
FT                   RPFLIQDLNVDIGLPRSMSDEWLSKHRGTSHPLQPEDTATGNSPTTVPYLIAMASYSKV
FT                   IGKVWEALYGASTSDSTPSPFLKEYLELLITQSQSDLQPEFSYDPQRPGSYRARGLAWW
FT                   QIKQQLMMRIRWSSLYLLIRKPMLQRKGASSLPVPEAIENEVICMRLAQSIIEDFSNVA
FT                   EDHPKYTFPFLHYLTSATIIALGLIIKQSSFKHTYGELTLEAARSLKKHCRKTWVSGRM
FT                   ARAVWKLNQMAEAIMNPGPRLTENLGSNDQQSSSSRPMSSSNHLSHESPKTCDNALQER
FT                   VQFNLSSSDCLADSTLSASCRRTQIRQAIDRDPPVAGHMDLDESPFMPNDFPFEERHTP
FT                   AHTSGHRPPRHHPHELHSGGVQTAGMEPGLPGDTNDTDPNTGVLSTSLPISGMDMIGSD
FT                   QNAWLPGEMIDGGIEWLQELFVSDLDSHVPSAWNW"
     MRRKHGGHSR IAIETSSNTK EPISNVVVSV SAGKLKQGKS RFIEPQDKSD QNTSRSPKLY        60
     TRSHQEDVPE DQNGHKGLPD ESITPFSGET SLAHNMTVVE DRLEQMGVRY ARLRSESPNH       120
     SFSSQLTPSP QASPKGNRPQ QTKSYVYQAL DSHKIVPDRV QWDRAMKTFC DEVHILVPFL       180
     HLPSVWEAYE RLWESFLVPS ANHYSRGEWR FTFACVLLCL ANGTCVESSR VDGQQGQYSA       240
     GWSLYRAARD VIGDLLDVFG ECTDQILLLQ NILLMVIYLF RLDSHGPAEK LLALSISHSH       300
     HIGLQRRQVV EAMNPFESEM ARRLWWCIYL MDRRLAIETG RPFLIQDLNV DIGLPRSMSD       360
     EWLSKHRGTS HPLQPEDTAT GNSPTTVPYL IAMASYSKVI GKVWEALYGA STSDSTPSPF       420
     LKEYLELLIT QSQSDLQPEF SYDPQRPGSY RARGLAWWQI KQQLMMRIRW SSLYLLIRKP       480
     MLQRKGASSL PVPEAIENEV ICMRLAQSII EDFSNVAEDH PKYTFPFLHY LTSATIIALG       540
     LIIKQSSFKH TYGELTLEAA RSLKKHCRKT WVSGRMARAV WKLNQMAEAI MNPGPRLTEN       600
     LGSNDQQSSS SRPMSSSNHL SHESPKTCDN ALQERVQFNL SSSDCLADST LSASCRRTQI       660
     RQAIDRDPPV AGHMDLDESP FMPNDFPFEE RHTPAHTSGH RPPRHHPHEL HSGGVQTAGM       720
     EPGLPGDTND TDPNTGVLST SLPISGMDMI GSDQNAWLPG EMIDGGIEWL QELFVSDLDS       780
     HVPSAWNW                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page