(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE275

PENCW_13.PE275       Location/Qualifiers
FT   CDS             join(616170..616279,616344..616773)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128679"
FT                   /orf_name="Pc16g02750"
FT                   /product="Pc16g02750 protein"
FT                   /protein_id="CAP92945.1"
FT                   /db_xref="UniParc:UPI0001831B1C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7I9"
FT                   /transl_table=1
FT                   /translation="MKLSIFLIALMTSVSSAQDPGPSPTASVGCEPHGDHWHCDGPAST
FT                   DVSSVTSTSAAEVSTTASPTMPSPTESVGCEPHGDHWHCDGPAETGTEAEASTTSATAS
FT                   PTMPSPTESVGCEPHGDHWHCDGPAETGSASASASASASASASTSAGDEEGAAGSIGVQ
FT                   VSLLAGLSLVAAGLNL"
     MKLSIFLIAL MTSVSSAQDP GPSPTASVGC EPHGDHWHCD GPASTDVSSV TSTSAAEVST        60
     TASPTMPSPT ESVGCEPHGD HWHCDGPAET GTEAEASTTS ATASPTMPSP TESVGCEPHG       120
     DHWHCDGPAE TGSASASASA SASASASTSA GDEEGAAGSI GVQVSLLAGL SLVAAGLNL        179
//

If you have problems or comments...

PBIL Back to PBIL home page