(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE276

PENCW_13.PE276       Location/Qualifiers
FT   CDS             join(complement(621464..621483),complement(621373..621395),
FT                   complement(621252..621290),complement(621081..621186),
FT                   complement(620882..621015),complement(619558..620809),
FT                   complement(619208..619501),complement(619018..619155),
FT                   complement(618568..618963),complement(618406..618505))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947671"
FT                   /orf_name="Pc16g02760"
FT                   /product="Pc16g02760 protein"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92946.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI0001831B1D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J0"
FT                   /transl_table=1
FT                   /translation="MASNLPAQPNLRVTIIAADGLYKRDVFRFPDPFAVATVGGEQTHT
FT                   TSVIKKTLNPYWNEPFDLRVNEDSILAIQIFDQKKFKKKDQGFLGVINVRIGDVIDLSM
FT                   GGDEMLTRDLKKSNDNLVVHGKLIINLSSNLTTPHPNQNGLQRQQAQTSTSSGLVPQVA
FT                   APTSQSQAGPSNIDTSPAAASSSSLTQRTSATAPPAGAPPSLNGAPTNPPGPGVPSRTN
FT                   LSSFEDSQGRLPAGYERREDNLGRTYYVDHNTRTTTWSRPSANYNEHAQRSQREANMQL
FT                   ERRAHQSRMLPEDRTGANSPNLPDAQQIPTPPPGPNAGTSLASGAPAGSNAAAISMMAT
FT                   GATTAGTGELPPGWERRVTPEGRPYFVDHNTRTTTWVDPRRQQYIRMYGQGQTTGGANN
FT                   TTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQGVPQYKRD
FT                   FRRKLIYFRSQPALRIMSGQCHVKVRRNNIFEDSYAEIMRQSASDLKKRLMIKFDGEDG
FT                   LDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPHSGVNPEHLNYFKFIGRVV
FT                   GLAIFHRRFLDSFFIGAFYKMMLRKKVSLQDMEGVDEDLHRNLAWTLDNDIDGIVELTF
FT                   SVDDEKFGERRTIDLIPGGRDIPVTNENKPQYIELVTEWKIMKRVEEQFDAFMSGFNEL
FT                   IPPDLVNVFDERELELLIGGIADIDVEDWKKHTDYRGYQEQDEVIQNFWKIVRTWDAEQ
FT                   KSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKSGDPAALPKSHTCFNRLDLPPYKT
FT                   HDALEHKMSIAVEETLGFGQE"
     MASNLPAQPN LRVTIIAADG LYKRDVFRFP DPFAVATVGG EQTHTTSVIK KTLNPYWNEP        60
     FDLRVNEDSI LAIQIFDQKK FKKKDQGFLG VINVRIGDVI DLSMGGDEML TRDLKKSNDN       120
     LVVHGKLIIN LSSNLTTPHP NQNGLQRQQA QTSTSSGLVP QVAAPTSQSQ AGPSNIDTSP       180
     AAASSSSLTQ RTSATAPPAG APPSLNGAPT NPPGPGVPSR TNLSSFEDSQ GRLPAGYERR       240
     EDNLGRTYYV DHNTRTTTWS RPSANYNEHA QRSQREANMQ LERRAHQSRM LPEDRTGANS       300
     PNLPDAQQIP TPPPGPNAGT SLASGAPAGS NAAAISMMAT GATTAGTGEL PPGWERRVTP       360
     EGRPYFVDHN TRTTTWVDPR RQQYIRMYGQ GQTTGGANNT TIQQQPVSQL GPLPSGWEMR       420
     LTNTARVYFV DHNTKTTTWD DPRLPSSLDQ GVPQYKRDFR RKLIYFRSQP ALRIMSGQCH       480
     VKVRRNNIFE DSYAEIMRQS ASDLKKRLMI KFDGEDGLDY GGLSREFFFL LSHEMFNPFY       540
     CLFEYSAHDN YTLQINPHSG VNPEHLNYFK FIGRVVGLAI FHRRFLDSFF IGAFYKMMLR       600
     KKVSLQDMEG VDEDLHRNLA WTLDNDIDGI VELTFSVDDE KFGERRTIDL IPGGRDIPVT       660
     NENKPQYIEL VTEWKIMKRV EEQFDAFMSG FNELIPPDLV NVFDERELEL LIGGIADIDV       720
     EDWKKHTDYR GYQEQDEVIQ NFWKIVRTWD AEQKSRLLQF TTGTSRIPVN GFKDLQGSDG       780
     PRRFTIEKSG DPAALPKSHT CFNRLDLPPY KTHDALEHKM SIAVEETLGF GQE              833
//

If you have problems or comments...

PBIL Back to PBIL home page