(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE277

PENCW_13.PE277       Location/Qualifiers
FT   CDS             join(complement(623085..623165),complement(622685..622941),
FT                   complement(622532..622619),complement(622325..622474))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977564"
FT                   /orf_name="Pc16g02770"
FT                   /product="Pc16g02770 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP92947.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831BED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J1"
FT                   /transl_table=1
FT                   /translation="MAAEGQEIPEEIKGEKVPAQEDGVDDEEEIEAMKRRVAEMESEAA
FT                   KLREMQADLDQQTESLQENKEDIDARSIFVGNVDYGASPEEIQAHFQSCGSINRVTILL
FT                   DKFSGQPKGYAYVEFAEPSLVAQALVLNESVFRGRNLKVVPKRTNLPGMHRGRGRGFGR
FT                   GRGRGFPRGGGYRGGAPYRGRGRGFSPY"
     MAAEGQEIPE EIKGEKVPAQ EDGVDDEEEI EAMKRRVAEM ESEAAKLREM QADLDQQTES        60
     LQENKEDIDA RSIFVGNVDY GASPEEIQAH FQSCGSINRV TILLDKFSGQ PKGYAYVEFA       120
     EPSLVAQALV LNESVFRGRN LKVVPKRTNL PGMHRGRGRG FGRGRGRGFP RGGGYRGGAP       180
     YRGRGRGFSP Y                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page