(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE278

PENCW_13.PE278       Location/Qualifiers
FT   CDS             join(complement(625021..625077),complement(624481..624894),
FT                   complement(624312..624428))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000293431" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977565"
FT                   /orf_name="Pc16g02780"
FT                   /product="Pc16g02780 protein"
FT                   /protein_id="CAP92948.1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="UniParc:UPI0001831BEE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J2"
FT                   /transl_table=1
FT                   /translation="MTARLVLVIGDLFIPDRAPFRKLLTPGKIGQTLCLGNLTDRETYD
FT                   FLREVAPDLQMVKGDYDVDSPNLPLSRIVNHGSLRIGFTHGHTIVPPADADALLIAARQ
FT                   MDVDVLLWGGTHRFEAFEMEGRFFINPGSATGAMSSGFWPDGEEPTPSFCLMDIQGDVL
FT                   VLYVYQLKTDANGVENVAVEKVSFRKNHPPAS"
     MTARLVLVIG DLFIPDRAPF RKLLTPGKIG QTLCLGNLTD RETYDFLREV APDLQMVKGD        60
     YDVDSPNLPL SRIVNHGSLR IGFTHGHTIV PPADADALLI AARQMDVDVL LWGGTHRFEA       120
     FEMEGRFFIN PGSATGAMSS GFWPDGEEPT PSFCLMDIQG DVLVLYVYQL KTDANGVENV       180
     AVEKVSFRKN HPPAS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page