(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE279

PENCW_13.PE279       Location/Qualifiers
FT   CDS             join(626252..626340,626397..627465)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171814" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947672"
FT                   /orf_name="Pc16g02790"
FT                   /product="Pc16g02790 protein"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="CAP92949.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI0001831BEF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J3"
FT                   /transl_table=1
FT                   /translation="MSAQAPHNTLLIPGPIEFDDAVLQSMSHYAESHVAPGFVKVFGET
FT                   LTLVRKLFQSTNPTAQPFIIAGSGTLGWDLVSANLIERGENALVLNTGYFGDSFGQCLE
FT                   TYGANVTHLKAPIGDRTPLEQVEQALKEKPYKLITLTHVDTSTGVLGDVKGVAQLVRRV
FT                   SPNTLVVVDGVCSVGSEEIAFDEWDLDAVVTASQKAIGCPPGLSIVMTSGRAIQAAQSR
FT                   KTPPGAYYASIANWLPIMQNYENNKPSYFATPPTQLVHALHTTLTQITADVPGRFAIHT
FT                   EVSDKVKAAVAELGLKQVASYPECQAHGMTAMYLPEGLVPADVLPGLLKRGVIFAAGLH
FT                   KEIATKYIRFGHMGVTVTDPKRGDVDKALAALKEALAEAKQAKGL"
     MSAQAPHNTL LIPGPIEFDD AVLQSMSHYA ESHVAPGFVK VFGETLTLVR KLFQSTNPTA        60
     QPFIIAGSGT LGWDLVSANL IERGENALVL NTGYFGDSFG QCLETYGANV THLKAPIGDR       120
     TPLEQVEQAL KEKPYKLITL THVDTSTGVL GDVKGVAQLV RRVSPNTLVV VDGVCSVGSE       180
     EIAFDEWDLD AVVTASQKAI GCPPGLSIVM TSGRAIQAAQ SRKTPPGAYY ASIANWLPIM       240
     QNYENNKPSY FATPPTQLVH ALHTTLTQIT ADVPGRFAIH TEVSDKVKAA VAELGLKQVA       300
     SYPECQAHGM TAMYLPEGLV PADVLPGLLK RGVIFAAGLH KEIATKYIRF GHMGVTVTDP       360
     KRGDVDKALA ALKEALAEAK QAKGL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page