(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE280

PENCW_13.PE280       Location/Qualifiers
FT   CDS             join(628343..628470,628565..628666,628728..629085)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824331"
FT                   /orf_name="Pc16g02800"
FT                   /product="Pc16g02800 protein"
FT                   /protein_id="CAP92950.1"
FT                   /db_xref="UniParc:UPI0001831BF0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J4"
FT                   /transl_table=1
FT                   /translation="MHYLNSTLPFLLAAATFTLADTAATTTTTSADNAVNTTSASENII
FT                   LQECIQSVRSNLGNCAPDDWDCRCTNSMDVVDCYTNCREDTSKKDAETTRQRDCANAKA
FT                   HASISVATSTVSSSRAAATGTDIDDGTDISDSEVETDSEGDSINSYSGLEANLFVRPEE
FT                   GAASGLRMRGWLRFLGHAPGVSLLVLGAGLRF"
     MHYLNSTLPF LLAAATFTLA DTAATTTTTS ADNAVNTTSA SENIILQECI QSVRSNLGNC        60
     APDDWDCRCT NSMDVVDCYT NCREDTSKKD AETTRQRDCA NAKAHASISV ATSTVSSSRA       120
     AATGTDIDDG TDISDSEVET DSEGDSINSY SGLEANLFVR PEEGAASGLR MRGWLRFLGH       180
     APGVSLLVLG AGLRF                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page