(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE281

PENCW_13.PE281       Location/Qualifiers
FT   CDS             join(complement(629790..630202),complement(629279..629726))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128680"
FT                   /orf_name="Pc16g02810"
FT                   /product="Pc16g02810 protein"
FT                   /protein_id="CAP92951.1"
FT                   /db_xref="UniParc:UPI0001831BF1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J5"
FT                   /transl_table=1
FT                   /translation="MEPTTSEHEPKTTKWDEGQIYVKACHNATRKLLVCLLSRSNEKKL
FT                   NLTTAGLDLSSGDSPDYGPRFVKPFSHDKMREYVEREQPWDDRWDIHSLCIPDEPELYK
FT                   YRLWRNAHHVAGILHLTLENFWGYDWPHGLVDEDNELGSLYRNQSQWYLEGWTIAKDTS
FT                   QPHINAFVSDSQPHRVGRLNSGEVSLAYGLIAKRRLQEGYNDHRYIPITMFSMSNFTVR
FT                   ILQIWHDKQNPKALQVRSSRIMDFKGGIQNNLDDWITILCWMTGEPVGDTKNGTEVAKV
FT                   IEREE"
     MEPTTSEHEP KTTKWDEGQI YVKACHNATR KLLVCLLSRS NEKKLNLTTA GLDLSSGDSP        60
     DYGPRFVKPF SHDKMREYVE REQPWDDRWD IHSLCIPDEP ELYKYRLWRN AHHVAGILHL       120
     TLENFWGYDW PHGLVDEDNE LGSLYRNQSQ WYLEGWTIAK DTSQPHINAF VSDSQPHRVG       180
     RLNSGEVSLA YGLIAKRRLQ EGYNDHRYIP ITMFSMSNFT VRILQIWHDK QNPKALQVRS       240
     SRIMDFKGGI QNNLDDWITI LCWMTGEPVG DTKNGTEVAK VIEREE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page