(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE282

PENCW_13.PE282       Location/Qualifiers
FT   CDS             join(complement(632540..632932),complement(632248..632481),
FT                   complement(631752..632154),complement(631650..631691),
FT                   complement(631396..631591),complement(631071..631341),
FT                   complement(630977..631018))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671652"
FT                   /orf_name="Pc16g02820"
FT                   /product="Pc16g02820 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92952.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831BF2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J6"
FT                   /transl_table=1
FT                   /translation="MDTLIRDSLFGRLSNSLISNKLWPYPNLEACKFETLSTSPTSTIS
FT                   VTPEPSQQFIVEFSGDDDPDMPRNWSLLSKTLVTLDIMLLNFSFYAASAIFTPSIPGIE
FT                   EQFGATTAEGTLGLSLFVIAYGIGPLFLSPLSNLPAIGRTPVYVLGSLIFCLLNIGAAL
FT                   GKNVETILILRFFGGFFGSAPISVGGATLMEVYGPGEAPYAIALYAIFGTLAMFVPSYI
FT                   YALVMVANSHSERWHTWTASLWLLSGITAFTTLFIFFLLPETLSSNILLRRAQRLREHT
FT                   GNPLYRSKSEMDTPTTSFGAMIFKQTVDDLKLSCMDPVIIFVNIHTMLIYGILYLWFEF
FT                   FPFVFDGIYHFTPIQQALAFFGILVGAAISVVSYMLWLRFSYQPRVSKVESSIEPEARL
FT                   VPGQIGAICIPICLFMFAWTSRPGVHWVVPIIGTAFFAPGFYLTFQSVLNYLGESYPRH
FT                   VASVFAGNTFFRSSFGGALPLAAPRMLQSLGIVWASSTLGFISIAMLPLPFILERYGKT
FT                   LRSWSKFAN"
     MDTLIRDSLF GRLSNSLISN KLWPYPNLEA CKFETLSTSP TSTISVTPEP SQQFIVEFSG        60
     DDDPDMPRNW SLLSKTLVTL DIMLLNFSFY AASAIFTPSI PGIEEQFGAT TAEGTLGLSL       120
     FVIAYGIGPL FLSPLSNLPA IGRTPVYVLG SLIFCLLNIG AALGKNVETI LILRFFGGFF       180
     GSAPISVGGA TLMEVYGPGE APYAIALYAI FGTLAMFVPS YIYALVMVAN SHSERWHTWT       240
     ASLWLLSGIT AFTTLFIFFL LPETLSSNIL LRRAQRLREH TGNPLYRSKS EMDTPTTSFG       300
     AMIFKQTVDD LKLSCMDPVI IFVNIHTMLI YGILYLWFEF FPFVFDGIYH FTPIQQALAF       360
     FGILVGAAIS VVSYMLWLRF SYQPRVSKVE SSIEPEARLV PGQIGAICIP ICLFMFAWTS       420
     RPGVHWVVPI IGTAFFAPGF YLTFQSVLNY LGESYPRHVA SVFAGNTFFR SSFGGALPLA       480
     APRMLQSLGI VWASSTLGFI SIAMLPLPFI LERYGKTLRS WSKFAN                      526
//

If you have problems or comments...

PBIL Back to PBIL home page