(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE283

PENCW_13.PE283       Location/Qualifiers
FT   CDS             join(633685..634368,634418..634969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947673"
FT                   /orf_name="Pc16g02830"
FT                   /product="Pc16g02830 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92953.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0001831BF3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J7"
FT                   /transl_table=1
FT                   /translation="MKVRKQVPPRKKACQSCTDSKVRCGLEKPTCSRCRARGKQCRYPA
FT                   GSGDVHQSSPMVSSEQISADESLTFGLSPANLSATSTVTAFSSPVSGHPSDIPRIYSQH
FT                   ESTQTVDTDLNFDHIDLVPMIDAEKIRDRWLQPYLLTATEQVPKLFNPFTVQFVTCVLR
FT                   SYPNHLLDEKSLPPFIHPLQLNSKAMPRTIANCFSLVRMWMNRVAGSEAIVLSTVRQEM
FT                   ERLSREDATSDFDTLCSFQVYLIYLLTAYFFPIENASLGDDMSMITIQDLAFRVAKAGF
FT                   TCKAELSQTRPTWESWIIASAKRRTLFTMYIFSNVYNSDKGLPNFLSDELGDILVPESK
FT                   ALWEASDRDSWTREYNRHLSKWEDGMLKISELWRSSETGSEARRKRIGRWVQSTDEFGM
FT                   MLFAVCAHIHGC"
     MKVRKQVPPR KKACQSCTDS KVRCGLEKPT CSRCRARGKQ CRYPAGSGDV HQSSPMVSSE        60
     QISADESLTF GLSPANLSAT STVTAFSSPV SGHPSDIPRI YSQHESTQTV DTDLNFDHID       120
     LVPMIDAEKI RDRWLQPYLL TATEQVPKLF NPFTVQFVTC VLRSYPNHLL DEKSLPPFIH       180
     PLQLNSKAMP RTIANCFSLV RMWMNRVAGS EAIVLSTVRQ EMERLSREDA TSDFDTLCSF       240
     QVYLIYLLTA YFFPIENASL GDDMSMITIQ DLAFRVAKAG FTCKAELSQT RPTWESWIIA       300
     SAKRRTLFTM YIFSNVYNSD KGLPNFLSDE LGDILVPESK ALWEASDRDS WTREYNRHLS       360
     KWEDGMLKIS ELWRSSETGS EARRKRIGRW VQSTDEFGMM LFAVCAHIHG C                411
//

If you have problems or comments...

PBIL Back to PBIL home page