(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE284

PENCW_13.PE284       Location/Qualifiers
FT   CDS             635906..>636211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947674"
FT                   /orf_name="Pc16g02840"
FT                   /product="Putative uncharacterized protein Pc16g02840 "
FT                   /protein_id="CAP92954.1"
FT                   /db_xref="UniParc:UPI0001831BF4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7J8"
FT                   /transl_table=1
FT                   /translation="MLSLALLQSLQGDLNELTRGIQYLCLIRRIVTGEFRQLRDVPIAV
FT                   GRPFAGGVIKNGAVIVSNNLQIVQGSFARVVVHGLEGCGRGRKGFSEAEILARPPIR"
     MLSLALLQSL QGDLNELTRG IQYLCLIRRI VTGEFRQLRD VPIAVGRPFA GGVIKNGAVI        60
     VSNNLQIVQG SFARVVVHGL EGCGRGRKGF SEAEILARPP IR                          102
//

If you have problems or comments...

PBIL Back to PBIL home page