(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE287

PENCW_13.PE287       Location/Qualifiers
FT   CDS             641734..642885
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128681"
FT                   /orf_name="Pc16g02870"
FT                   /product="Pc16g02870 protein"
FT                   /protein_id="CAP92957.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831BF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K1"
FT                   /transl_table=1
FT                   /translation="MAAEKRFLVPDEKILSDIFPGVVGLKPSSCNVISNTFDICTFSVQ
FT                   VEVIPLIVRLETEKSETSKSRLATVAALSRLGHLQLNDIVPSIQQIGTATTIDTKVNYL
FT                   VTEYLTGTVLLEDIWNTLDETNQLELVDSVVCAMDKLQKLGDIKNVYKYLTATPYISND
FT                   KTPVAIGGPGIGYFPDIKDFLEGILQKHKRPGCKLLGTDGGLSIQSEYDDIGQIDLSHS
FT                   DLDELQHCVVFCHNDLEPRNILVRKSSSGKYKLAGVIDWEMAGFFPFAYEYGVKDTYLG
FT                   RENLYFSWYTMFKGKASYLLPQMECHTKFIKAVRIIEKSKKKAMSRNVGVRVQEKWIQR
FT                   EKVEESSDIREGWIRKAGEKSQVFTKEDMKELENEVLKELGYI"
     MAAEKRFLVP DEKILSDIFP GVVGLKPSSC NVISNTFDIC TFSVQVEVIP LIVRLETEKS        60
     ETSKSRLATV AALSRLGHLQ LNDIVPSIQQ IGTATTIDTK VNYLVTEYLT GTVLLEDIWN       120
     TLDETNQLEL VDSVVCAMDK LQKLGDIKNV YKYLTATPYI SNDKTPVAIG GPGIGYFPDI       180
     KDFLEGILQK HKRPGCKLLG TDGGLSIQSE YDDIGQIDLS HSDLDELQHC VVFCHNDLEP       240
     RNILVRKSSS GKYKLAGVID WEMAGFFPFA YEYGVKDTYL GRENLYFSWY TMFKGKASYL       300
     LPQMECHTKF IKAVRIIEKS KKKAMSRNVG VRVQEKWIQR EKVEESSDIR EGWIRKAGEK       360
     SQVFTKEDMK ELENEVLKEL GYI                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page