(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE288

PENCW_13.PE288       Location/Qualifiers
FT   CDS             join(643493..643508,643567..643603,643700..645002)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977566"
FT                   /orf_name="Pc16g02880"
FT                   /product="Pc16g02880 protein"
FT                   /protein_id="CAP92958.1"
FT                   /db_xref="UniParc:UPI0001831BF8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K2"
FT                   /transl_table=1
FT                   /translation="MAGTGARAVCSVANDASRYGVGCPGYKRPWQFKDEGPRLQKRYQK
FT                   KCSNARTHSEAINSNGIFTKFSIDERVHPALVHQSFISQQPQVFKEFICAAFPTMFFHN
FT                   EFRFGNGFNFADCVVKHFGSKQYHDASVSCLSAEYLGHLTGDPRLHQFGRQEYSKALGA
FT                   IRRALNSEEALSDSLLLAVILLSIYEMNTRTTRDAWVYHSRAVKQLLLRRRTTFCLSGV
FT                   GRVCHFAYRPFLIAAALYEGEPCFLADDNWQDLAAFLRMEDSQKQSEWAFYINVYETIF
FT                   MELVKCPGYIKEAREIVSVTSPKARLLAQRICIAGDRLRTLSDELRSLLASHNQRKEGI
FT                   IFRSFVGPQPNAFPETSPSLLLRAAVTATSILEELFIRLTTPAYAKGESPSSSRGTPQS
FT                   VGVSGAGGPLLDFRFTFELGGRTEKDNPCHFTWLDRVAGSMGLLGAEITYVE"
     MAGTGARAVC SVANDASRYG VGCPGYKRPW QFKDEGPRLQ KRYQKKCSNA RTHSEAINSN        60
     GIFTKFSIDE RVHPALVHQS FISQQPQVFK EFICAAFPTM FFHNEFRFGN GFNFADCVVK       120
     HFGSKQYHDA SVSCLSAEYL GHLTGDPRLH QFGRQEYSKA LGAIRRALNS EEALSDSLLL       180
     AVILLSIYEM NTRTTRDAWV YHSRAVKQLL LRRRTTFCLS GVGRVCHFAY RPFLIAAALY       240
     EGEPCFLADD NWQDLAAFLR MEDSQKQSEW AFYINVYETI FMELVKCPGY IKEAREIVSV       300
     TSPKARLLAQ RICIAGDRLR TLSDELRSLL ASHNQRKEGI IFRSFVGPQP NAFPETSPSL       360
     LLRAAVTATS ILEELFIRLT TPAYAKGESP SSSRGTPQSV GVSGAGGPLL DFRFTFELGG       420
     RTEKDNPCHF TWLDRVAGSM GLLGAEITYV E                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page