(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE289

PENCW_13.PE289       Location/Qualifiers
FT   CDS             645422..646165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076657" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824333"
FT                   /orf_name="Pc16g02890"
FT                   /product="Pc16g02890 protein"
FT                   /protein_id="CAP92959.1"
FT                   /db_xref="UniParc:UPI0001831BF9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K3"
FT                   /transl_table=1
FT                   /translation="MPFSSRHERKPSRGRAHRKAGGSMTGDKDIWELDLERSGEINILQ
FT                   RYRLRQHLRRPSHDDSERPFISHRLYFIEEDLREVVQEEISIKEGLDVLEKCGKEKERL
FT                   DVLNTKYWLLERQWWHYHSCLEDGYELRGFELWRSHPKWYMHRDLIKDCASRQGCCARG
FT                   CGCCLRRKIDPTRAFGVGHCTFECGCCRRARGFEIPEGDKILLKEKCREEIGKLPTHRI
FT                   VRVAIWGLVGDSYDNPFDMIDAPPS"
     MPFSSRHERK PSRGRAHRKA GGSMTGDKDI WELDLERSGE INILQRYRLR QHLRRPSHDD        60
     SERPFISHRL YFIEEDLREV VQEEISIKEG LDVLEKCGKE KERLDVLNTK YWLLERQWWH       120
     YHSCLEDGYE LRGFELWRSH PKWYMHRDLI KDCASRQGCC ARGCGCCLRR KIDPTRAFGV       180
     GHCTFECGCC RRARGFEIPE GDKILLKEKC REEIGKLPTH RIVRVAIWGL VGDSYDNPFD       240
     MIDAPPS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page