(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE29

PENCW_13.PE29        Location/Qualifiers
FT   CDS             join(65728..66138,66198..66557)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000133453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823844"
FT                   /orf_name="Pc16g00290"
FT                   /product="Pc16g00290 protein"
FT                   /protein_id="CAP92699.1"
FT                   /db_xref="UniParc:UPI0001831DB9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T6"
FT                   /transl_table=1
FT                   /translation="MSVNPVFVFVPGAWHTADSFDVVRDLMHNRGLATEAISTPSVGAF
FT                   PPDKGLHADIEHTHAVLKEMVEAGCQIVLVNHSYGGMVGAGAVKGLGYTERRKAGLPGG
FT                   VIMVVWMAAFVTPKGKTLMDMLGGKHAPWMVINSPDDGYCWSSDQETIFYNDMSPEAQQ
FT                   EAISKLKPHTYRSFNEPATHEPWREMPSMYMFFDKDGAISLAVQENFAQTLGNPVTYHV
FT                   DASHSAFLSVPEKVIEGLEIALKEGRQQSGIAVN"
     MSVNPVFVFV PGAWHTADSF DVVRDLMHNR GLATEAISTP SVGAFPPDKG LHADIEHTHA        60
     VLKEMVEAGC QIVLVNHSYG GMVGAGAVKG LGYTERRKAG LPGGVIMVVW MAAFVTPKGK       120
     TLMDMLGGKH APWMVINSPD DGYCWSSDQE TIFYNDMSPE AQQEAISKLK PHTYRSFNEP       180
     ATHEPWREMP SMYMFFDKDG AISLAVQENF AQTLGNPVTY HVDASHSAFL SVPEKVIEGL       240
     EIALKEGRQQ SGIAVN                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page