(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE290

PENCW_13.PE290       Location/Qualifiers
FT   CDS             join(646701..646875,646923..647145,647210..647441)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128682"
FT                   /orf_name="Pc16g02900"
FT                   /product="Putative uncharacterized protein Pc16g02900 "
FT                   /protein_id="CAP92960.1"
FT                   /db_xref="UniParc:UPI0001831BFA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7K4"
FT                   /transl_table=1
FT                   /translation="MEDAKEVVAKHRWNGYKRLKRAVRKFLGNNIDRRQLQEATDQIDA
FT                   SETKFPTVAITTLSVFADVFFGLFLTHPFSPSASPPHNEESMALEVLHLADKRGPILAL
FT                   EVGGVVFLVLVLMRTLSLVYWYIRLKILLKLDPDGRYDNDTRWTVIDTLTDMEASQDPM
FT                   KASLPYSLDDEGLYFHPSDAEPSLCLPKSMTKKVFALVHDDQGHCI"
     MEDAKEVVAK HRWNGYKRLK RAVRKFLGNN IDRRQLQEAT DQIDASETKF PTVAITTLSV        60
     FADVFFGLFL THPFSPSASP PHNEESMALE VLHLADKRGP ILALEVGGVV FLVLVLMRTL       120
     SLVYWYIRLK ILLKLDPDGR YDNDTRWTVI DTLTDMEASQ DPMKASLPYS LDDEGLYFHP       180
     SDAEPSLCLP KSMTKKVFAL VHDDQGHCI                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page