(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE291

PENCW_13.PE291       Location/Qualifiers
FT   CDS             join(648289..648719,648778..649444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128683"
FT                   /orf_name="Pc16g02910"
FT                   /product="Pc16g02910 protein"
FT                   /protein_id="CAP92961.1"
FT                   /db_xref="UniParc:UPI0001831BFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8P9"
FT                   /transl_table=1
FT                   /translation="MAKETKTRTLNVQPEKSQGEDDNKHVSFHPRQITLETFRNLLYQY
FT                   PSTVERVHRSKLMIKLQSKGKAKAPKRKAETKTSAAPATKADLDPSEEKHILEESDQFL
FT                   QLDRWRYEVLPKLIAERANGSAEGAHLVKEELIDIMEWKTKHGVSRPMLMGMVKSNPAT
FT                   TITKSTSTAFAALPDADPLVAPNDTFPKASLDALTAPIRGVGPATASLILSIATVFGDA
FT                   KKQVPFYSDDVYLWLCLMDFPEGPDVKEQKPSKHKKPNGELIVKYNMHEYRELWNASQA
FT                   LRARLNNAAGENSGDGPVSFIDIERAAYVLRNLAISDYFASQEAEDGSNVVKDVESPND
FT                   SLPKQPEKDSSELGTRRSKRTKKEA"
     MAKETKTRTL NVQPEKSQGE DDNKHVSFHP RQITLETFRN LLYQYPSTVE RVHRSKLMIK        60
     LQSKGKAKAP KRKAETKTSA APATKADLDP SEEKHILEES DQFLQLDRWR YEVLPKLIAE       120
     RANGSAEGAH LVKEELIDIM EWKTKHGVSR PMLMGMVKSN PATTITKSTS TAFAALPDAD       180
     PLVAPNDTFP KASLDALTAP IRGVGPATAS LILSIATVFG DAKKQVPFYS DDVYLWLCLM       240
     DFPEGPDVKE QKPSKHKKPN GELIVKYNMH EYRELWNASQ ALRARLNNAA GENSGDGPVS       300
     FIDIERAAYV LRNLAISDYF ASQEAEDGSN VVKDVESPND SLPKQPEKDS SELGTRRSKR       360
     TKKEA                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page