(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE292

PENCW_13.PE292       Location/Qualifiers
FT   CDS             join(complement(650830..650845),complement(650708..650784),
FT                   complement(649670..650587))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947676"
FT                   /orf_name="Pc16g02920"
FT                   /product="Putative uncharacterized protein Pc16g02920 "
FT                   /protein_id="CAP92962.1"
FT                   /db_xref="UniParc:UPI0001831BFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q0"
FT                   /transl_table=1
FT                   /translation="MSLNQAPISQSGRMLVPVEEKIKTSGDFWNWQRLRAAVFPFLPVN
FT                   IEDTLPLVDEHPTSMQTIESNMGEVIPHHKAVDIPIDSHGNLDEDCTENQDEVNEHELS
FT                   RQVRPAFDTALEENDTKVISNTCCTESPVVSSSESVEGATAKEDLPSPPTSPVPTTTNN
FT                   PTYPIYHNLIPPPPIPLDATTQSRIDKKFQSAIKETPTIRLIVDIPPHLVDWSNPITSI
FT                   TTTINPFLSHWETQNKVNLLAVEIRHGHAYAAIEVNNHNYDFKTAHKQTFVFPVYVLKV
FT                   GRGFRWRFYRAPAVDVSVMNEIKTVHYLHREEVGTPYLVFRVGGREPVSGESRED"
     MSLNQAPISQ SGRMLVPVEE KIKTSGDFWN WQRLRAAVFP FLPVNIEDTL PLVDEHPTSM        60
     QTIESNMGEV IPHHKAVDIP IDSHGNLDED CTENQDEVNE HELSRQVRPA FDTALEENDT       120
     KVISNTCCTE SPVVSSSESV EGATAKEDLP SPPTSPVPTT TNNPTYPIYH NLIPPPPIPL       180
     DATTQSRIDK KFQSAIKETP TIRLIVDIPP HLVDWSNPIT SITTTINPFL SHWETQNKVN       240
     LLAVEIRHGH AYAAIEVNNH NYDFKTAHKQ TFVFPVYVLK VGRGFRWRFY RAPAVDVSVM       300
     NEIKTVHYLH REEVGTPYLV FRVGGREPVS GESRED                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page