(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE293

PENCW_13.PE293       Location/Qualifiers
FT   CDS             complement(651563..653518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671653"
FT                   /orf_name="Pc16g02930"
FT                   /product="Pc16g02930 protein"
FT                   /protein_id="CAP92963.1"
FT                   /db_xref="UniParc:UPI0001831BFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q1"
FT                   /transl_table=1
FT                   /translation="MLAPNCTGINTLSLPQLKRKRSDSDSDATDAPAPTKVCADSVSTR
FT                   PTPTLIADSVAPTPSTPTTSSNSPVASARPPAQDAVARPSVTRLRETITAQLSLEVLLK
FT                   HNELRLIDQEIAKCQVALEQLRRCGEIPYPGSRVTGVSPDVSLGTGASVLAPGNGPAPM
FT                   SPAPWGVTEGPYARHYARWLLPDPRFDGGEVDSGMPNSLVEGRSTRGNPGEMGMLAGKT
FT                   RPQRGSTATKHTALSSGYPVVKEKSGPMLIRRKSDGVLVKLVCLDCRRDNFSSTQGFIN
FT                   HCRIAHNRNFASHDAAAMACGQSVQVDDAGTVVGGSAEPTANPTTPGYVHPLIRSTHVA
FT                   TTPWKSLRTPAKDSVTPRTPAAATTSAVATPPSTAEPAYRRRSEPIRQPPNPQFLASPA
FT                   TPHLSALMKSRGAGLNMDKLVEESRTPVDLGALFDDDSETDDSRPSGASHTSLGARAGR
FT                   QPMRMPASQTAGESESRKALDRGHSPPTEHATPSRPQSFLDLSLAGQSQSRESNSLDHQ
FT                   ALSPHAIESNQAPSLVSDDEDDYEVASDSDSPASSEEDEQEQEFRHIHVEDDERAAAPS
FT                   ATAEAKPGPSLASPAPQSGPPLSQPLKRSRSKKISSIVPFGDNDDQHVGYIHSPSADNA
FT                   AKAKRAAERKPNQSKR"
     MLAPNCTGIN TLSLPQLKRK RSDSDSDATD APAPTKVCAD SVSTRPTPTL IADSVAPTPS        60
     TPTTSSNSPV ASARPPAQDA VARPSVTRLR ETITAQLSLE VLLKHNELRL IDQEIAKCQV       120
     ALEQLRRCGE IPYPGSRVTG VSPDVSLGTG ASVLAPGNGP APMSPAPWGV TEGPYARHYA       180
     RWLLPDPRFD GGEVDSGMPN SLVEGRSTRG NPGEMGMLAG KTRPQRGSTA TKHTALSSGY       240
     PVVKEKSGPM LIRRKSDGVL VKLVCLDCRR DNFSSTQGFI NHCRIAHNRN FASHDAAAMA       300
     CGQSVQVDDA GTVVGGSAEP TANPTTPGYV HPLIRSTHVA TTPWKSLRTP AKDSVTPRTP       360
     AAATTSAVAT PPSTAEPAYR RRSEPIRQPP NPQFLASPAT PHLSALMKSR GAGLNMDKLV       420
     EESRTPVDLG ALFDDDSETD DSRPSGASHT SLGARAGRQP MRMPASQTAG ESESRKALDR       480
     GHSPPTEHAT PSRPQSFLDL SLAGQSQSRE SNSLDHQALS PHAIESNQAP SLVSDDEDDY       540
     EVASDSDSPA SSEEDEQEQE FRHIHVEDDE RAAAPSATAE AKPGPSLASP APQSGPPLSQ       600
     PLKRSRSKKI SSIVPFGDND DQHVGYIHSP SADNAAKAKR AAERKPNQSK R                651
//

If you have problems or comments...

PBIL Back to PBIL home page