(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE294

PENCW_13.PE294       Location/Qualifiers
FT   CDS             join(complement(656704..656737),complement(656118..656464))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208407" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947677"
FT                   /orf_name="Pc16g02940"
FT                   /product="Pc16g02940 protein"
FT                   /protein_id="CAP92964.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI000004EC06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q2"
FT                   /transl_table=1
FT                   /translation="MSSQPLLQTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGG
FT                   LAVGLLNFGDRIGRISAALFTIIAMGAMIYALVTFHWRAQSIRRRGQSGIDDRFGPTIL
FT                   AIALLAAVVVNFILRIKDGQMN"
     MSSQPLLQTA PGKRIALPTR VEPKVFFANE RTFLSWLNFT VILGGLAVGL LNFGDRIGRI        60
     SAALFTIIAM GAMIYALVTF HWRAQSIRRR GQSGIDDRFG PTILAIALLA AVVVNFILRI       120
     KDGQMN                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page