(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE295

PENCW_13.PE295       Location/Qualifiers
FT   CDS             join(complement(659945..660190),complement(659704..659883),
FT                   complement(658631..659639),complement(658147..658571))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947678"
FT                   /orf_name="Pc16g02950"
FT                   /product="Pc16g02950 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on CH-OH group
FT                   of donors"
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAP92965.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0016614"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI0001831BFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q3"
FT                   /transl_table=1
FT                   /translation="MAENPTCAIEEFTRTIFDYVICGGGTAGLTLAVRLSENPAVTVGV
FT                   IEAGKYRIGDPLVDTPAAFPQTFENPEYDWCVYSVPQEGNRGVAHHIPRGKLLGGSSGI
FT                   NYMMYVRGSTKDYDNWAELLEDDGWSGEHMQHYMRKHQTLEPIDPSITDRSTMPLVGEF
FT                   HGTSGPIRTGFNDSILPVENDIIKACEDVAGITNKPHDPWSGDHIGFYHTLGAVIRTGP
FT                   NKGKRSYAARGYYEENRATRPNLKVLCEALVNRVVLDGNKATGVSLTHEGVEYQVSARR
FT                   EVIVSGGTIQSPQILELSGIGDPEVLKAAGVECKVANSAVGGNVIDHALSFIVMEVQPG
FT                   IMTLDTLSQVPEAMAAARKQYAETGGGPLTAVSSMQGFFPAKSILSETELAEIIQSIRD
FT                   IKPNSAFHAKQLEQTIANLEDGHSANMQFVTVPGSMNPDAIGHQGNIILPRSADQPAGV
FT                   TLEACLQYPVSRGTIHIESADPTKHPIVNPNYGGHPADISLLAAFLRWCDKVTESEHVK
FT                   SSFLRRAFPDPKVNLQDMDAAREAVHDLVVGEYHISGSVAMGAALDSRLRVKGVEGLRV
FT                   VDASVLSNNVSGNIVSTVYAIAEKAADLIREDWDFSAAKETIA"
     MAENPTCAIE EFTRTIFDYV ICGGGTAGLT LAVRLSENPA VTVGVIEAGK YRIGDPLVDT        60
     PAAFPQTFEN PEYDWCVYSV PQEGNRGVAH HIPRGKLLGG SSGINYMMYV RGSTKDYDNW       120
     AELLEDDGWS GEHMQHYMRK HQTLEPIDPS ITDRSTMPLV GEFHGTSGPI RTGFNDSILP       180
     VENDIIKACE DVAGITNKPH DPWSGDHIGF YHTLGAVIRT GPNKGKRSYA ARGYYEENRA       240
     TRPNLKVLCE ALVNRVVLDG NKATGVSLTH EGVEYQVSAR REVIVSGGTI QSPQILELSG       300
     IGDPEVLKAA GVECKVANSA VGGNVIDHAL SFIVMEVQPG IMTLDTLSQV PEAMAAARKQ       360
     YAETGGGPLT AVSSMQGFFP AKSILSETEL AEIIQSIRDI KPNSAFHAKQ LEQTIANLED       420
     GHSANMQFVT VPGSMNPDAI GHQGNIILPR SADQPAGVTL EACLQYPVSR GTIHIESADP       480
     TKHPIVNPNY GGHPADISLL AAFLRWCDKV TESEHVKSSF LRRAFPDPKV NLQDMDAARE       540
     AVHDLVVGEY HISGSVAMGA ALDSRLRVKG VEGLRVVDAS VLSNNVSGNI VSTVYAIAEK       600
     AADLIREDWD FSAAKETIA                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page