(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE296

PENCW_13.PE296       Location/Qualifiers
FT   CDS             complement(661257..662447)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671654"
FT                   /orf_name="Pc16g02960"
FT                   /product="Pc16g02960 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92966.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Q4"
FT                   /transl_table=1
FT                   /translation="MPPLRAHTKSRNGCDQCRIRRVKCDEKGPPCSNCTTRELKCTYLK
FT                   VAARRAATHITPPSSTSDVLQSLDGHGSPVAAMPGPAVATIPVSAPTQTNSFGINNLEL
FT                   MHKFATETYKSLCISDSEMQIWKITVPTLALKHDYLMNGILALASLHIATTCGPSEVAL
FT                   MYYEAGLQYYNRSLTPFRNAIDSITPHNCDAVFAHSIVMIAIGIASPQLTGMKDECAST
FT                   TKNIVILFELLQGVKKILQVSKSWIKLELFSQGEFWKNTPAELDPDTEAALTHLSDLND
FT                   RVMVGVYSEQHRINKTVIAHLRHCYAKFAHSADPAPAFAWLAAVEKGFVDSLRCRQPFS
FT                   LLILMYWGVLLRELDGLRWWARDAGRVLVSELFDALRSGDPRWQSALGWVQRKMGL"
     MPPLRAHTKS RNGCDQCRIR RVKCDEKGPP CSNCTTRELK CTYLKVAARR AATHITPPSS        60
     TSDVLQSLDG HGSPVAAMPG PAVATIPVSA PTQTNSFGIN NLELMHKFAT ETYKSLCISD       120
     SEMQIWKITV PTLALKHDYL MNGILALASL HIATTCGPSE VALMYYEAGL QYYNRSLTPF       180
     RNAIDSITPH NCDAVFAHSI VMIAIGIASP QLTGMKDECA STTKNIVILF ELLQGVKKIL       240
     QVSKSWIKLE LFSQGEFWKN TPAELDPDTE AALTHLSDLN DRVMVGVYSE QHRINKTVIA       300
     HLRHCYAKFA HSADPAPAFA WLAAVEKGFV DSLRCRQPFS LLILMYWGVL LRELDGLRWW       360
     ARDAGRVLVS ELFDALRSGD PRWQSALGWV QRKMGL                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page