(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE30

PENCW_13.PE30        Location/Qualifiers
FT   CDS             complement(67094..68347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823845"
FT                   /orf_name="Pc16g00300"
FT                   /product="Pc16g00300 protein"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92700.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001831E8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T7"
FT                   /transl_table=1
FT                   /translation="MYPRTIKITLSLPRGRLSICTNAQHQFHRLSGTLRMTQPMQSIPS
FT                   CGRRGIVTLPNKSHHVIQEPDMKKEASFNQNVFNLSLALSKSRINDATELRCMVLGLDG
FT                   SVKESDIRGTRDGLAKEWGLDGRDLRNVDLVSEGIPHLLVRPSVIFISMFTLRLLVRAH
FT                   GVLLFLLPIEDCHVKVQDVFMTDLQRRLHPGSGSGLLAKLPFELRVVDAALASVIATLE
FT                   AEHVLIRREVQDSLQDSTREDVVYAVLRDLQDHRKRLVAIQQRASQFRSALREILENDE
FT                   DMATMFLTDRQAGRPHEVEDHLEVEYLLEAYYKNTDAIAESANALLGDLERTVETIHSV
FT                   LDVRRNQIMVFEAQLEICMLGFAVPTFVAGLFGMNVANFFEESTSAFVVLVAVCVMGTV
FT                   TIAKYGLWKLDKFRKLRF"
     MYPRTIKITL SLPRGRLSIC TNAQHQFHRL SGTLRMTQPM QSIPSCGRRG IVTLPNKSHH        60
     VIQEPDMKKE ASFNQNVFNL SLALSKSRIN DATELRCMVL GLDGSVKESD IRGTRDGLAK       120
     EWGLDGRDLR NVDLVSEGIP HLLVRPSVIF ISMFTLRLLV RAHGVLLFLL PIEDCHVKVQ       180
     DVFMTDLQRR LHPGSGSGLL AKLPFELRVV DAALASVIAT LEAEHVLIRR EVQDSLQDST       240
     REDVVYAVLR DLQDHRKRLV AIQQRASQFR SALREILEND EDMATMFLTD RQAGRPHEVE       300
     DHLEVEYLLE AYYKNTDAIA ESANALLGDL ERTVETIHSV LDVRRNQIMV FEAQLEICML       360
     GFAVPTFVAG LFGMNVANFF EESTSAFVVL VAVCVMGTVT IAKYGLWKLD KFRKLRF          417
//

If you have problems or comments...

PBIL Back to PBIL home page