(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE300

PENCW_13.PE300       Location/Qualifiers
FT   CDS             join(672254..672470,672527..672545,672615..673344)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947680"
FT                   /orf_name="Pc16g03000"
FT                   /product="Pc16g03000 protein"
FT                   /protein_id="CAP92970.1"
FT                   /db_xref="UniParc:UPI0001831CD5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L4"
FT                   /transl_table=1
FT                   /translation="MFLLLYDLVACLYNVVSTLKVPKACGCFGSLLSCLSTALLFHSHL
FT                   SEIPLPRLHYHIPTSPFFVHFLIHASHAASGTAPGYRSNQARDTHHTTRQNSQPPTIAF
FT                   VNSESRQVVLERGRILESVEGNDLKWLWVQPRRDTLHLIGRKCYTLFRGLMMTPRVQLS
FT                   NSYCMRCILGSATDAVVAYSMPVLQLAEAIDSMKRIKKIGQNAIDVHRKELITEILAIV
FT                   LMVIPFAGKALGPLICSATPMARIALLVGEMGNGGLVVAALSAILGLIAGIDSGTGKLS
FT                   KGEALVEASNARGLLKASDLAKSPEGFRNFDQPLGCSQIS"
     MFLLLYDLVA CLYNVVSTLK VPKACGCFGS LLSCLSTALL FHSHLSEIPL PRLHYHIPTS        60
     PFFVHFLIHA SHAASGTAPG YRSNQARDTH HTTRQNSQPP TIAFVNSESR QVVLERGRIL       120
     ESVEGNDLKW LWVQPRRDTL HLIGRKCYTL FRGLMMTPRV QLSNSYCMRC ILGSATDAVV       180
     AYSMPVLQLA EAIDSMKRIK KIGQNAIDVH RKELITEILA IVLMVIPFAG KALGPLICSA       240
     TPMARIALLV GEMGNGGLVV AALSAILGLI AGIDSGTGKL SKGEALVEAS NARGLLKASD       300
     LAKSPEGFRN FDQPLGCSQI S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page