(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE304

PENCW_13.PE304       Location/Qualifiers
FT   CDS             join(complement(682910..683213),complement(682631..682833))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947683"
FT                   /orf_name="Pc16g03040"
FT                   /product="Putative uncharacterized protein Pc16g03040 "
FT                   /protein_id="CAP92974.1"
FT                   /db_xref="UniParc:UPI0001831CD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L8"
FT                   /transl_table=1
FT                   /translation="MQSWISFLPYLLFQFSTCISGVQAKRGGGGGDSDDSYSDDNSGGS
FT                   SSTDSCATSKHPTIWKWDLIPSNADNYTSGDISGEDTSYDGSFFKGEASLHYTITEDKY
FT                   CRCRSNLAADLNTSDLALECCVCWRLQVTTMANQASRENPHKIPVLDSVYSGLRQNSTF
FT                   ILPTV"
     MQSWISFLPY LLFQFSTCIS GVQAKRGGGG GDSDDSYSDD NSGGSSSTDS CATSKHPTIW        60
     KWDLIPSNAD NYTSGDISGE DTSYDGSFFK GEASLHYTIT EDKYCRCRSN LAADLNTSDL       120
     ALECCVCWRL QVTTMANQAS RENPHKIPVL DSVYSGLRQN STFILPTV                    168
//

If you have problems or comments...

PBIL Back to PBIL home page