(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE306

PENCW_13.PE306       Location/Qualifiers
FT   CDS             join(685322..685426,685481..686066,686122..686372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671655"
FT                   /orf_name="Pc16g03060"
FT                   /product="Pc16g03060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92976.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831CDA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7L9"
FT                   /transl_table=1
FT                   /translation="MVKVAVAGGTGGVGRTIVEELLRQDKHNVIILSRKSTPLPGLPSV
FT                   PVSAIDYDDIASVATFLREHSVDVVISTLSLFTEEVGKAQMNLIQAAIESSAVNRFIPS
FT                   EFAFNYSHPGLLDFHAAAQMRIDAADLLRSSHVDFTRFVFGWMLDTWNPVRAKSHMPPM
FT                   SWVLGFENRRARIPGDGKAPLTFLHSFDLAKFVAALLDEENRWPETSAFAGDRITFNEV
FT                   VELAESIMGQKWEVTYEPVSRLEKKDVVVFEQPEGSYDFGEGLRDVTAEFGLIVVKDMM
FT                   DASVDGLRNMDFPNVRPITVEAWMHQIWGKKA"
     MVKVAVAGGT GGVGRTIVEE LLRQDKHNVI ILSRKSTPLP GLPSVPVSAI DYDDIASVAT        60
     FLREHSVDVV ISTLSLFTEE VGKAQMNLIQ AAIESSAVNR FIPSEFAFNY SHPGLLDFHA       120
     AAQMRIDAAD LLRSSHVDFT RFVFGWMLDT WNPVRAKSHM PPMSWVLGFE NRRARIPGDG       180
     KAPLTFLHSF DLAKFVAALL DEENRWPETS AFAGDRITFN EVVELAESIM GQKWEVTYEP       240
     VSRLEKKDVV VFEQPEGSYD FGEGLRDVTA EFGLIVVKDM MDASVDGLRN MDFPNVRPIT       300
     VEAWMHQIWG KKA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page