(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE307

PENCW_13.PE307       Location/Qualifiers
FT   CDS             join(687451..687653,687717..687923,687994..688098,
FT                   688187..688275,688305..688341,688371..689454)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977567"
FT                   /orf_name="Pc16g03070"
FT                   /product="Pc16g03070 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92977.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI0001831CDB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7M0"
FT                   /transl_table=1
FT                   /translation="MDDRELVSILHPGLGAVFKGVKTAEFLDQKSSSVAQFRGIKFARI
FT                   PTRFRRAILHENFPPIVDATNHGPICPQSIGQRKFEDLLNGASPESLAVAGQLESPVMD
FT                   EFECLNLVITAPVLKSTESVAEELFPVMIYIHGGGNFVGANSFWFNDGRHLVKKGMESN
FT                   LPTVIVALNYRLSALGWLSSQTLREYNAAFGDVGVGNYDDANKSTQAAMMFADKIHKHL
FT                   GIEWVYRNISGFGGDPNNITIFGESAGGFAVDNQIHSQLPCRFSQAILQSGVMSSHMSS
FT                   PLPLSDQDTLFDLVKARAHVNTVEELRDIPVDVLLQAFAKASSETGFSAVPTIDDEMFT
FT                   QSWAEHYSFANEDFRVIIGHTTYERSLFEILAHLHSEAKDNDQSFERICSSFLAHIEGM
FT                   EATELCEAYGYQDDIQPARLKQCLMKILEDIVFVTPINEATTRYIQKGLAVYRYIFDEP
FT                   NPFKGAFSGKSNHALDLPYLFGSASIFAGVENKDWEQDIQDSLQTKWLLFAHGIPPWPS
FT                   VSDGKFLVFGPHGTVNEHSSTELISKSLSISDDIFGSLELGYRAELSMLVWKHARLL"
     MDDRELVSIL HPGLGAVFKG VKTAEFLDQK SSSVAQFRGI KFARIPTRFR RAILHENFPP        60
     IVDATNHGPI CPQSIGQRKF EDLLNGASPE SLAVAGQLES PVMDEFECLN LVITAPVLKS       120
     TESVAEELFP VMIYIHGGGN FVGANSFWFN DGRHLVKKGM ESNLPTVIVA LNYRLSALGW       180
     LSSQTLREYN AAFGDVGVGN YDDANKSTQA AMMFADKIHK HLGIEWVYRN ISGFGGDPNN       240
     ITIFGESAGG FAVDNQIHSQ LPCRFSQAIL QSGVMSSHMS SPLPLSDQDT LFDLVKARAH       300
     VNTVEELRDI PVDVLLQAFA KASSETGFSA VPTIDDEMFT QSWAEHYSFA NEDFRVIIGH       360
     TTYERSLFEI LAHLHSEAKD NDQSFERICS SFLAHIEGME ATELCEAYGY QDDIQPARLK       420
     QCLMKILEDI VFVTPINEAT TRYIQKGLAV YRYIFDEPNP FKGAFSGKSN HALDLPYLFG       480
     SASIFAGVEN KDWEQDIQDS LQTKWLLFAH GIPPWPSVSD GKFLVFGPHG TVNEHSSTEL       540
     ISKSLSISDD IFGSLELGYR AELSMLVWKH ARLL                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page