(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE308

PENCW_13.PE308       Location/Qualifiers
FT   CDS             join(complement(692440..692618),complement(691966..692300),
FT                   complement(691609..691910),complement(691391..691556),
FT                   complement(691141..691331))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128686"
FT                   /orf_name="Pc16g03080"
FT                   /product="Pc16g03080 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP92978.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831CDC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X0"
FT                   /transl_table=1
FT                   /translation="MLTSFLQSLPRLGRRWTPLNFTNPNFIQLSASQAIEEETIPGYIA
FT                   GRYYPTRIGEILKDRYRRYVTLKIFIKSTSMGQQLDDELKIYKRIEGAPQKHPGRKYVR
FT                   SLLDSFDISGPEDKHRCLVHPPLWESMLDFLFRNPVQRLPTPILAVTLHRLFLALDYLH
FT                   TECKIIHTDIKADNIMFGIADDSVLSDFENTELQHPCPRKELDGRTIYTSRELRMPKNL
FT                   GAPILCDFGSAVIGDKEHSEDIQPDIYRAPEVILQAPWSYSVDIWNVGCVIWNLFEGGS
FT                   LFSGQDPEFQTYRSRAHLAEMIRLLGPPSPSFLARGNLTQRFFSQEGDLYAGELVGEHI
FT                   PLEQRETSLEGEEKEMFLRLMRKMLQWEPEKRSSAMELEQDEWVQAELHK"
     MLTSFLQSLP RLGRRWTPLN FTNPNFIQLS ASQAIEEETI PGYIAGRYYP TRIGEILKDR        60
     YRRYVTLKIF IKSTSMGQQL DDELKIYKRI EGAPQKHPGR KYVRSLLDSF DISGPEDKHR       120
     CLVHPPLWES MLDFLFRNPV QRLPTPILAV TLHRLFLALD YLHTECKIIH TDIKADNIMF       180
     GIADDSVLSD FENTELQHPC PRKELDGRTI YTSRELRMPK NLGAPILCDF GSAVIGDKEH       240
     SEDIQPDIYR APEVILQAPW SYSVDIWNVG CVIWNLFEGG SLFSGQDPEF QTYRSRAHLA       300
     EMIRLLGPPS PSFLARGNLT QRFFSQEGDL YAGELVGEHI PLEQRETSLE GEEKEMFLRL       360
     MRKMLQWEPE KRSSAMELEQ DEWVQAELHK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page