(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE309

PENCW_13.PE309       Location/Qualifiers
FT   CDS             join(696176..696248,696299..698309,698371..698773)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128687"
FT                   /orf_name="Pc16g03090"
FT                   /product="Pc16g03090 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP92979.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001831CDD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X1"
FT                   /transl_table=1
FT                   /translation="MPQTFDVEHVLANISEQDKIALLSGIDFWHTHPIPEFNVPSIRAT
FT                   DGPNGIRGTKFFAGIPAACLPCGTALGATWDRDLIYQAGELLGDECIAKGAHCWLGPTI
FT                   NMQRAPLGGRGFESFAEDPHLSGILAKSIILGCESKGVISTVKHFVGNDQEHERRAVDV
FT                   LVTQRALREIYLRPFQIVARDAKPGALMTSYNKINGKHVVEDERMLNLIREEWKWNPLV
FT                   MSDWYGTYTTIDSMNAGLDLEMPGVSRYRGKFIESAVQARLIKQSTVDARARKVLEFVK
FT                   QASQVQVSEVERGRDLPEDRALNRKLCANSIVLLKNEGILPLPREIKKIALIGSHMKCP
FT                   AISGGGSASLEPYYSVSLYDACREALPDAEVLYQVGAYAHKMLPVIDRLLSNAIIQFYN
FT                   EPMCKERHLISTEPVSTTAFQFMDYYAPGLNRALFWATLIGDFTPDTSGIWDFGLSVFG
FT                   TANLYIDDELVIDNTTSQTRGTAFFGKGTVEVLGSKELVAGTIYKVRIEFGSANTTTMK
FT                   TVGMVNFGGGAASLGACLRMNREEMIENAVEAATEADYTILCTGLNKDWESEGFDRMHM
FT                   DLPPGVDELISKVLKAAADKTVIVNQSGTPVTMPWADQARCIVQGWYGGNETGHGIADV
FT                   LFGEVNPCAKLPLSWPVDVKHNPAYLNYASVGGRVLYGEDIYGGYRFYEKTGREVLFPF
FT                   GHGLSYTTFNVSPNVTVAPEIFNMDVPTVATVQIKNTGKLAGAQILQLYISAPESSTPR
FT                   PSKELHGFEKVFVQPGEEKTVNIQLDRYATSFWDEIEDMWKSEQGTYEVLIGTSSQEVV
FT                   ARGKFQVDRTSYWRGL"
     MPQTFDVEHV LANISEQDKI ALLSGIDFWH THPIPEFNVP SIRATDGPNG IRGTKFFAGI        60
     PAACLPCGTA LGATWDRDLI YQAGELLGDE CIAKGAHCWL GPTINMQRAP LGGRGFESFA       120
     EDPHLSGILA KSIILGCESK GVISTVKHFV GNDQEHERRA VDVLVTQRAL REIYLRPFQI       180
     VARDAKPGAL MTSYNKINGK HVVEDERMLN LIREEWKWNP LVMSDWYGTY TTIDSMNAGL       240
     DLEMPGVSRY RGKFIESAVQ ARLIKQSTVD ARARKVLEFV KQASQVQVSE VERGRDLPED       300
     RALNRKLCAN SIVLLKNEGI LPLPREIKKI ALIGSHMKCP AISGGGSASL EPYYSVSLYD       360
     ACREALPDAE VLYQVGAYAH KMLPVIDRLL SNAIIQFYNE PMCKERHLIS TEPVSTTAFQ       420
     FMDYYAPGLN RALFWATLIG DFTPDTSGIW DFGLSVFGTA NLYIDDELVI DNTTSQTRGT       480
     AFFGKGTVEV LGSKELVAGT IYKVRIEFGS ANTTTMKTVG MVNFGGGAAS LGACLRMNRE       540
     EMIENAVEAA TEADYTILCT GLNKDWESEG FDRMHMDLPP GVDELISKVL KAAADKTVIV       600
     NQSGTPVTMP WADQARCIVQ GWYGGNETGH GIADVLFGEV NPCAKLPLSW PVDVKHNPAY       660
     LNYASVGGRV LYGEDIYGGY RFYEKTGREV LFPFGHGLSY TTFNVSPNVT VAPEIFNMDV       720
     PTVATVQIKN TGKLAGAQIL QLYISAPESS TPRPSKELHG FEKVFVQPGE EKTVNIQLDR       780
     YATSFWDEIE DMWKSEQGTY EVLIGTSSQE VVARGKFQVD RTSYWRGL                    828
//

If you have problems or comments...

PBIL Back to PBIL home page